Clone RE11491 Report

Search the DGRC for RE11491

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:114
Well:91
Vector:pFlc-1
Associated Gene/TranscriptCtr1B-RA
Protein status:RE11491.pep: gold
Preliminary Size:628
Sequenced Size:963

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7459 2001-12-14 Blastp of sequenced clone
CG7459 2002-01-01 Sim4 clustering to Release 2
CG7459 2003-01-01 Sim4 clustering to Release 3
Ctr1B 2008-04-29 Release 5.5 accounting
Ctr1B 2008-08-15 Release 5.9 accounting
Ctr1B 2008-12-18 5.12 accounting

Clone Sequence Records

RE11491.complete Sequence

963 bp (963 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071033

> RE11491.complete
CGGGTCAACGCTCTGCTCTCAGCACCTCAGCAGGTCTAGCTCTTATCACT
GTGCCTCCCCGATCGCCAGTCGGATTTTCCACGCCTTCTATCTATATCTA
TACTACACCAGCAGCCCAAGATGGATCACGGCTCGGATGACAGCACCAGC
ACGGCCAAGTCCTGCCCTATGATCATGGTGTTCCACGCTGGACACTGCGA
GCGAATTTTGTGGCGCGGATGGGTGGCGTCCACTGTGACGGAGTTCGTGC
TCTCCGCCCTGGCCATCTTCCTGGTGTCCTTCCTGTATGAGGCGCTCAAG
TTCCTGCGACAGCAACTGGCGCGCAGGGAAGCCCGTCGAGCAAGCGAGCA
GCTGGCGGCGGAGCAGCGTAGGAAGAACGAGGCTCCGGCAGCCGGAGGAT
GCTGCTCGGAAGCTCCCCTGGCGGAGCCGAGGGAGCAGACCTACTGGCAG
CGCTTGTTCGCCTCGTCGCACATCGTCCAGTCCCTGCTGAACCTGCTGCA
GATCGTCATCTCGTACCTGCTGATGCTGATCTTCATGACCTTCAACTACT
GGCTGTGCCTGGCAGTGATCCTGGGACTGGGTCTGGGCTACTTCTTCTTC
GGCTGGAACAAGAAGAATCCCGACGAGAGCGAGTGCTGTCCTTAGATCAA
GAATATCGCTCTTAATTGTTTATATATCTTGCAATTGTTATAAACTAAGC
CCTTATCAGTTCTTGGTTCACACATCAAAGAAAAAGTCCCGTCCCCACGT
AATTATACAAATTGTTTAAAAATACAATTTTATTCGATAGTTACACTTGG
TTTAATTGTTATTGATGTAATCGTAGCATAAATTAGTCAACTAGTTTACT
TAATGAGCATATTGTACAAATAGTGTAGTCATGAGAACAAGAACCTATAC
AACGCGTATTCATCTAAAGCGATTAAAGTACTACTCAATACTTTTGACAA
AAAAAAAAAAAAA

RE11491.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:44:40
Subject Length Description Subject Range Query Range Score Percent Strand
Ctr1B-RA 1353 Ctr1B-RA 347..1291 4..948 4725 100 Plus
Ctr1B.a 1598 Ctr1B.a 624..1568 4..948 4725 100 Plus
Ctr1B.b 1395 Ctr1B.b 421..1365 4..948 4725 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:56:02
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 4144454..4145222 180..948 3845 100 Plus
chr3R 27901430 chr3R 4143637..4143813 4..180 885 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:33:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:56:00
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8318437..8319205 180..948 3845 100 Plus
3R 32079331 3R 8317620..8317796 4..180 885 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:11:21
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 8059268..8060036 180..948 3845 100 Plus
3R 31820162 3R 8058451..8058627 4..180 885 100 Plus
Blast to na_te.dros performed 2019-03-16 11:56:01
Subject Length Description Subject Range Query Range Score Percent Strand
TART-B 10654 TART-B DM14101 10654bp Derived from U14101 (g603662) (Rel. 42, Last updated, Version 1). 10164..10299 739..877 138 59.6 Plus
Dbif\P-element_O 2986 Dbif\P-element_O P_O 2986bp Derived from X71634. 2604..2729 720..839 112 57.1 Plus

RE11491.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:57:17 Download gff for RE11491.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 4143635..4143813 1..180 98 -> Plus
chr3R 4144455..4145222 181..948 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:54:07 Download gff for RE11491.complete
Subject Subject Range Query Range Percent Splice Strand
Ctr1B-RA 1..525 121..645 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:11:23 Download gff for RE11491.complete
Subject Subject Range Query Range Percent Splice Strand
Ctr1B-RA 1..525 121..645 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:31:50 Download gff for RE11491.complete
Subject Subject Range Query Range Percent Splice Strand
Ctr1B-RA 1..525 121..645 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:35:37 Download gff for RE11491.complete
Subject Subject Range Query Range Percent Splice Strand
Ctr1B-RA 1..525 121..645 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:30:28 Download gff for RE11491.complete
Subject Subject Range Query Range Percent Splice Strand
Ctr1B-RA 1..525 121..645 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:41:38 Download gff for RE11491.complete
Subject Subject Range Query Range Percent Splice Strand
Ctr1B-RA 3..947 4..948 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:11:23 Download gff for RE11491.complete
Subject Subject Range Query Range Percent Splice Strand
Ctr1B-RA 4..950 1..948 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:31:50 Download gff for RE11491.complete
Subject Subject Range Query Range Percent Splice Strand
Ctr1B-RA 7..953 1..948 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:35:38 Download gff for RE11491.complete
Subject Subject Range Query Range Percent Splice Strand
Ctr1B-RA 3..947 4..948 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:30:28 Download gff for RE11491.complete
Subject Subject Range Query Range Percent Splice Strand
Ctr1B-RA 7..953 1..948 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:57:17 Download gff for RE11491.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8317618..8317796 1..180 98 -> Plus
3R 8318438..8319205 181..948 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:57:17 Download gff for RE11491.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8317618..8317796 1..180 98 -> Plus
3R 8318438..8319205 181..948 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:57:17 Download gff for RE11491.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8317618..8317796 1..180 98 -> Plus
3R 8318438..8319205 181..948 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:31:50 Download gff for RE11491.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4143340..4143518 1..180 98 -> Plus
arm_3R 4144160..4144927 181..948 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:12:55 Download gff for RE11491.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8059269..8060036 181..948 100   Plus
3R 8058449..8058627 1..180 98 -> Plus

RE11491.hyp Sequence

Translation from 120 to 644

> RE11491.hyp
MDHGSDDSTSTAKSCPMIMVFHAGHCERILWRGWVASTVTEFVLSALAIF
LVSFLYEALKFLRQQLARREARRASEQLAAEQRRKNEAPAAGGCCSEAPL
AEPREQTYWQRLFASSHIVQSLLNLLQIVISYLLMLIFMTFNYWLCLAVI
LGLGLGYFFFGWNKKNPDESECCP*

RE11491.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:23:29
Subject Length Description Subject Range Query Range Score Percent Strand
Ctr1B-PA 174 CG7459-PA 1..174 1..174 920 100 Plus
Ctr1A-PB 231 CG3977-PB 66..220 2..164 276 37.4 Plus
Ctr1A-PA 231 CG3977-PA 66..220 2..164 276 37.4 Plus
Ctr1A-PD 241 CG3977-PD 66..230 2..164 274 36.5 Plus
Ctr1A-PC 241 CG3977-PC 66..230 2..164 274 36.5 Plus

RE11491.pep Sequence

Translation from 120 to 644

> RE11491.pep
MDHGSDDSTSTAKSCPMIMVFHAGHCERILWRGWVASTVTEFVLSALAIF
LVSFLYEALKFLRQQLARREARRASEQLAAEQRRKNEAPAAGGCCSEAPL
AEPREQTYWQRLFASSHIVQSLLNLLQIVISYLLMLIFMTFNYWLCLAVI
LGLGLGYFFFGWNKKNPDESECCP*

RE11491.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:15:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18342-PA 183 GF18342-PA 11..183 2..174 812 84.4 Plus
Dana\GF23301-PA 256 GF23301-PA 87..244 17..160 258 38.6 Plus
Dana\GF22272-PA 233 GF22272-PA 81..232 17..173 255 37.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:15:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25028-PA 178 GG25028-PA 6..178 2..174 898 96 Plus
Dere\GG19602-PA 241 GG19602-PA 79..240 17..173 246 36.3 Plus
Dere\GG11899-PA 270 GG11899-PA 63..267 17..169 218 31.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:15:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14206-PA 171 GH14206-PA 1..171 1..174 643 68.4 Plus
Dgri\GH24714-PA 228 GH24714-PA 75..227 17..173 247 38 Plus
Dgri\GH14352-PA 241 GH14352-PA 64..235 19..166 219 33.7 Plus
Dgri\GH23297-PA 241 GH23297-PA 64..235 19..166 218 33.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:17:40
Subject Length Description Subject Range Query Range Score Percent Strand
Ctr1B-PA 174 CG7459-PA 1..174 1..174 920 100 Plus
Ctr1A-PB 231 CG3977-PB 66..220 2..164 276 37.4 Plus
Ctr1A-PA 231 CG3977-PA 66..220 2..164 276 37.4 Plus
Ctr1A-PD 241 CG3977-PD 66..230 2..164 274 36.5 Plus
Ctr1A-PC 241 CG3977-PC 66..230 2..164 274 36.5 Plus
Ctr1C-PA 270 CG15551-PA 58..267 12..169 233 31.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:15:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24869-PA 177 GI24869-PA 6..177 1..174 607 63.1 Plus
Dmoj\GI21812-PA 234 GI21812-PA 72..233 17..173 246 36.3 Plus
Dmoj\GI10446-PA 232 GI10446-PA 59..226 19..166 228 37.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:15:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23430-PA 176 GL23430-PA 6..176 2..174 696 82.1 Plus
Dper\GL13345-PA 220 GL13345-PA 68..219 17..173 253 36.5 Plus
Dper\GL13975-PA 383 GL13975-PA 328..371 117..160 177 65.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:15:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20368-PA 176 GA20368-PA 6..176 2..174 697 82.1 Plus
Dpse\GA17816-PA 220 GA17816-PA 68..219 17..173 253 36.5 Plus
Dpse\GA13809-PA 376 GA13809-PA 321..364 117..160 178 65.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:15:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23723-PA 178 GM23723-PA 6..178 2..174 904 97.7 Plus
Dsec\GM12117-PA 240 GM12117-PA 63..237 17..169 256 37.1 Plus
Dsec\GM12509-PA 241 GM12509-PA 79..240 17..173 242 36.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:15:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15144-PA 178 GD15144-PA 6..178 2..174 907 98.3 Plus
Dsim\GD16719-PA 240 GD16719-PA 58..228 12..160 250 36.3 Plus
Dsim\GD16812-PA 241 GD16812-PA 79..240 17..173 242 36.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:15:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24513-PA 180 GJ24513-PA 10..180 2..174 683 72.3 Plus
Dvir\GJ16985-PA 231 GJ16985-PA 78..230 17..173 275 39.2 Plus
Dvir\GJ10663-PA 235 GJ10663-PA 64..229 19..166 239 35.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:15:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13179-PA 173 GK13179-PA 1..173 1..174 652 69 Plus
Dwil\GK25589-PA 229 GK25589-PA 77..228 17..173 250 36.5 Plus
Dwil\GK13100-PA 274 GK13100-PA 57..272 6..169 235 29.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:15:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25868-PA 178 GE25868-PA 6..178 2..174 901 96.5 Plus
Dyak\GE16762-PA 238 GE16762-PA 76..237 17..173 243 36.3 Plus
Dyak\GE23348-PA 274 GE23348-PA 63..271 17..169 217 31.1 Plus