Clone RE11532 Report

Search the DGRC for RE11532

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:115
Well:32
Vector:pFlc-1
Associated Gene/TranscriptCG1738-RA
Protein status:RE11532.pep: gold
Preliminary Size:590
Sequenced Size:807

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1738 2002-01-01 Sim4 clustering to Release 2
CG1738 2002-06-10 Blastp of sequenced clone
CG1738 2003-01-01 Sim4 clustering to Release 3
CG1738 2008-04-29 Release 5.5 accounting
CG1738 2008-08-15 Release 5.9 accounting
CG1738 2008-12-18 5.12 accounting

Clone Sequence Records

RE11532.complete Sequence

807 bp (807 high quality bases) assembled on 2002-06-10

GenBank Submission: AY121667

> RE11532.complete
CAGATGGACCGAGGCGTTACGTGGGAATTAGTACATTTTGGCACTGTACA
AGTGCATTCAATATTTTGATTTCACTATTATTGCTGCAAATAAACACAGA
AAACTGAAAGCATAATGAACGTCAGCGCCGATTTTAAGCCGGTGCCCACG
CGTGCAGCGTTGGCGCTGCAAAAGAAGCAGGAGAACACCGAATTTCAGGC
ACACGTCTTCCACGAATCGCACTTCCAATCGAAAAGTGGAACAAAAAAGC
AGGACGACGGCGTCCAAAAATCGCACAAAACCAAGGAGGGCGGCATGGAA
CTGAATCCCGAATTCGATATCAAGAAGGCGCGCCACGAGGTGCTCAATTT
TGCGATCAAAAACCAGCGTGTGATCAAAAACAAGAGCAAAATGGAAATGT
TTCAGCTGATCAAGCTGGGCGCCAAGCCGCTGAAGAAGGCCTCCAAAAAC
TACAAGGAGCTGAAGGACGAACGCCAGCGGCTGAAGAATATTCGCGAGGA
GCGCAAGAAGTTCCATCAGTTGGGCAAAAATCAAACGGGCGCCGCCAGCG
TCAAATGCCGAACAAAATCGCAAAAGGAGCGCAACGACAAGAGGCGCGCG
CCCGTTTCACACATCGATCAGCACTACGGCAAGGCGCAGCCCAAGTTTAA
GACGAGAAAATAGTTGTTTATATAGCTCTTAGTTAAATACTAAAACTAGC
TTAGTCAAAGGATGGCACTGTTTAAAAATCAATTTATCTATTCTAGCCCT
AACGTCAGGCTTAAATTATATAATATATAACTATACCAGCAAAAAAAAAA
AAAAAAA

RE11532.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:25:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG1738-RA 795 CG1738-RA 5..795 1..791 3940 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:08:26
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 11240202..11240991 1..790 3935 99.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:33:50 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:08:23
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11349058..11349848 1..791 3940 99.9 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:02:45
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 11357156..11357946 1..791 3940 99.8 Plus
Blast to na_te.dros performed on 2019-03-16 03:08:24 has no hits.

RE11532.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:09:11 Download gff for RE11532.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 11240202..11240991 1..790 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:54:08 Download gff for RE11532.complete
Subject Subject Range Query Range Percent Splice Strand
CG1738-RA 1..549 115..663 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:55:46 Download gff for RE11532.complete
Subject Subject Range Query Range Percent Splice Strand
CG1738-RA 1..549 115..663 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:42:23 Download gff for RE11532.complete
Subject Subject Range Query Range Percent Splice Strand
CG1738-RA 1..549 115..663 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:46:45 Download gff for RE11532.complete
Subject Subject Range Query Range Percent Splice Strand
CG1738-RA 1..549 115..663 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:31:57 Download gff for RE11532.complete
Subject Subject Range Query Range Percent Splice Strand
CG1738-RA 1..549 115..663 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:11:15 Download gff for RE11532.complete
Subject Subject Range Query Range Percent Splice Strand
CG1738-RA 5..794 1..790 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:55:46 Download gff for RE11532.complete
Subject Subject Range Query Range Percent Splice Strand
CG1738-RA 5..794 1..790 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:42:23 Download gff for RE11532.complete
Subject Subject Range Query Range Percent Splice Strand
CG1738-RA 10..799 1..790 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:46:45 Download gff for RE11532.complete
Subject Subject Range Query Range Percent Splice Strand
CG1738-RA 5..794 1..790 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:31:57 Download gff for RE11532.complete
Subject Subject Range Query Range Percent Splice Strand
CG1738-RA 10..799 1..790 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:09:11 Download gff for RE11532.complete
Subject Subject Range Query Range Percent Splice Strand
X 11349058..11349847 1..790 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:09:11 Download gff for RE11532.complete
Subject Subject Range Query Range Percent Splice Strand
X 11349058..11349847 1..790 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:09:11 Download gff for RE11532.complete
Subject Subject Range Query Range Percent Splice Strand
X 11349058..11349847 1..790 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:42:23 Download gff for RE11532.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 11243091..11243880 1..790 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:17:54 Download gff for RE11532.complete
Subject Subject Range Query Range Percent Splice Strand
X 11357156..11357945 1..790 99   Plus

RE11532.pep Sequence

Translation from 114 to 662

> RE11532.pep
MNVSADFKPVPTRAALALQKKQENTEFQAHVFHESHFQSKSGTKKQDDGV
QKSHKTKEGGMELNPEFDIKKARHEVLNFAIKNQRVIKNKSKMEMFQLIK
LGAKPLKKASKNYKELKDERQRLKNIREERKKFHQLGKNQTGAASVKCRT
KSQKERNDKRRAPVSHIDQHYGKAQPKFKTRK*

RE11532.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:33:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21764-PA 185 GF21764-PA 1..185 1..182 681 75.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:33:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18405-PA 182 GG18405-PA 1..182 1..182 887 93.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:33:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12178-PA 182 GH12178-PA 1..179 1..181 512 63 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:38:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG1738-PA 182 CG1738-PA 1..182 1..182 941 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:34:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15708-PA 180 GI15708-PA 1..179 1..181 549 65.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:34:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14847-PA 187 GL14847-PA 1..187 1..182 622 71.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:34:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14492-PA 187 GA14492-PA 1..187 1..182 623 71.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:34:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11471-PA 182 GM11471-PA 1..182 1..182 911 95.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:34:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17014-PA 177 GD17014-PA 1..177 6..182 861 92.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:34:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15236-PA 182 GJ15236-PA 1..181 1..181 559 64.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:34:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25330-PA 188 GK25330-PA 1..188 1..182 600 65.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:34:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15924-PA 182 GE15924-PA 1..182 1..182 870 91.8 Plus

RE11532.hyp Sequence

Translation from 114 to 662

> RE11532.hyp
MNVSADFKPVPTRAALALQKKQENTEFQAHVFHESHFQSKSGTKKQDDGV
QKSHKTKEGGMELNPEFDIKKARHEVLNFAIKNQRVIKNKSKMEMFQLIK
LGAKPLKKASKNYKELKDERQRLKNIREERKKFHQLGKNQTGAASVKCRT
KSQKERNDKRRAPVSHIDQHYGKAQPKFKTRK*

RE11532.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:24:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG1738-PA 182 CG1738-PA 1..182 1..182 941 100 Plus