Clone RE11685 Report

Search the DGRC for RE11685

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:116
Well:85
Vector:pFlc-1
Associated Gene/TranscriptTsp42Eg-RA
Protein status:RE11685.pep: gold
Preliminary Size:827
Sequenced Size:1202

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12142 2002-01-01 Sim4 clustering to Release 2
CG12142 2002-04-22 Blastp of sequenced clone
CG12142 2003-01-01 Sim4 clustering to Release 3
Tsp42Eg 2008-04-29 Release 5.5 accounting
Tsp42Eg 2008-08-15 Release 5.9 accounting
Tsp42Eg 2008-12-18 5.12 accounting

Clone Sequence Records

RE11685.complete Sequence

1202 bp (1202 high quality bases) assembled on 2002-04-22

GenBank Submission: AY113403

> RE11685.complete
AGTTTTCAGTTAACAGTCGAGCGGTGAGCATGAGCCCGGTTTTGGGTAAC
CCCAGCAACCGTTAGGTCCGAAATAAATATTTTCCGATTGTCAACAAGCC
GCGAGTTGCCAAGTGTTATAAATAATACGCGTAACCTCCTGCAAAGAAAC
AATAGATATATAGTTTCCGAAAATTGGATTGGCAAGATGGCCTGCTCCAC
AAACGTTTTGAAGGGCTTTGCCCTCTTTTGGGATATTATCCTCGCTCTGT
TCGGCCTGGTTGTTATCGGCCTTGGTGTGCACATCATCTACAAATTCGAG
CACTTCAACACGGCCGCCTTCGTCATCATCGCGGTGGGCGTGGTCGTCGT
TCTGACCGCCCTTTTCGGGGCTCTGGGAGCAGCGCGGGAGAGCAGTGCCA
CATCTAAGGTGTTCGTTGTTATTCTGATTGTCTTGGTCATACTGGAAGTT
CTAGCAGTTGGGTTCCTGTGGGTTTTCCAAACCTCGCTGCTGATTAACGT
GGACAAAACGTTTGATAAACTGTGGAATGACCAGCCGGTGCCAATCAAGC
CTGGCAACCAGAGTCAGATTGCCAGCCTCGAGCGATGGTTGGATTGCTGC
GGCAATGTGGGGCCCTCGGACTACATTCTGCCCCCGAATAGTTGCTACAA
CGGCGAGAGTGACAAACTGAATCTTGAAGGATGCCGGCAAAAGTTCCTGG
ACTTTATCGCCGATCGTTGGACGACATTTAATCTGGTTTCCCTGGTGCTA
TTGGGTGTGGAGCTGATTTGCGCCCTGTTGGCCTATGTCCTGGCCAATAG
CATCGTGAACCGCTGGCGACGCTCGAAGTACTATCAGAAATAGGTTCACA
TACCATTTTGAAATACATTGAAATGCATTTCGAAAATTCAAGTTTAAGCT
GCGCATACTTAAGACCAAAGAACTCTCCATACAAATACTTAAGCCGAAAC
TCGATAGAGATTCCAAAACAAATTTACTTAAGCCAAGCAAACCGAAAGCA
GTGCGTTGTTTGTATTCTATTTATCACTTTGGATAACTGCAATGTTGAAG
CGGATTCTATATTCCGCTTAGAATGTAACTTAATCTACACTAAGCTCGAC
CTAAGCCACAAATTTTCTGTAACAGCATTTCGAGGAGACAAGTCAAATAA
AGAATCTGGCCGAAGATCCAGAAGATCTGAAGATCTAAAAAAAAAAAAAA
AA

RE11685.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:13:30
Subject Length Description Subject Range Query Range Score Percent Strand
Tsp42Eg-RA 1315 Tsp42Eg-RA 32..1220 1..1189 5900 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:30:32
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 2920219..2920644 761..1186 2115 99.8 Plus
chr2R 21145070 chr2R 2916324..2916569 1..246 1215 99.6 Plus
chr2R 21145070 chr2R 2919737..2919914 411..588 875 99.4 Plus
chr2R 21145070 chr2R 2919982..2920156 588..762 875 100 Plus
chr2R 21145070 chr2R 2919159..2919323 247..411 810 99.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:33:59 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:30:30
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 7032808..7033236 761..1189 2130 99.8 Plus
2R 25286936 2R 7028913..7029158 1..246 1215 99.6 Plus
2R 25286936 2R 7032326..7032503 411..588 875 99.4 Plus
2R 25286936 2R 7032571..7032745 588..762 875 100 Plus
2R 25286936 2R 7031748..7031912 247..411 825 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:43:51
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 7034007..7034435 761..1189 2130 99.7 Plus
2R 25260384 2R 7030112..7030357 1..246 1215 99.5 Plus
2R 25260384 2R 7033525..7033702 411..588 875 99.4 Plus
2R 25260384 2R 7033770..7033944 588..762 875 100 Plus
2R 25260384 2R 7032947..7033111 247..411 825 100 Plus
Blast to na_te.dros performed on 2019-03-15 19:30:30 has no hits.

RE11685.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:31:12 Download gff for RE11685.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 2920221..2920644 763..1186 99   Plus
chr2R 2916324..2916569 1..246 99 -> Plus
chr2R 2919159..2919323 247..411 99 -> Plus
chr2R 2919738..2919914 412..588 99 -> Plus
chr2R 2919983..2920156 589..762 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:54:16 Download gff for RE11685.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp42Eg-RA 1..657 187..843 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:59:17 Download gff for RE11685.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp42Eg-RA 1..657 187..843 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:52:48 Download gff for RE11685.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp42Eg-RA 1..657 187..843 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:52:35 Download gff for RE11685.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp42Eg-RA 1..657 187..843 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:19:31 Download gff for RE11685.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp42Eg-RA 1..657 187..843 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:39:57 Download gff for RE11685.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp42Eg-RA 1..1186 1..1186 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:59:17 Download gff for RE11685.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp42Eg-RA 1..1186 1..1186 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:52:48 Download gff for RE11685.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp42Eg-RA 3..1188 1..1186 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:52:35 Download gff for RE11685.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp42Eg-RA 1..1186 1..1186 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:19:31 Download gff for RE11685.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp42Eg-RA 3..1188 1..1186 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:31:12 Download gff for RE11685.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7028913..7029158 1..246 99 -> Plus
2R 7031748..7031912 247..411 100 -> Plus
2R 7032327..7032503 412..588 99 -> Plus
2R 7032572..7032745 589..762 100 -> Plus
2R 7032810..7033233 763..1186 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:31:12 Download gff for RE11685.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7028913..7029158 1..246 99 -> Plus
2R 7031748..7031912 247..411 100 -> Plus
2R 7032327..7032503 412..588 99 -> Plus
2R 7032572..7032745 589..762 100 -> Plus
2R 7032810..7033233 763..1186 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:31:12 Download gff for RE11685.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7028913..7029158 1..246 99 -> Plus
2R 7031748..7031912 247..411 100 -> Plus
2R 7032327..7032503 412..588 99 -> Plus
2R 7032572..7032745 589..762 100 -> Plus
2R 7032810..7033233 763..1186 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:52:48 Download gff for RE11685.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 2920315..2920738 763..1186 99   Plus
arm_2R 2916418..2916663 1..246 99 -> Plus
arm_2R 2919253..2919417 247..411 100 -> Plus
arm_2R 2919832..2920008 412..588 99 -> Plus
arm_2R 2920077..2920250 589..762 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:24:41 Download gff for RE11685.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7030112..7030357 1..246 99 -> Plus
2R 7032947..7033111 247..411 100 -> Plus
2R 7033526..7033702 412..588 99 -> Plus
2R 7033771..7033944 589..762 100 -> Plus
2R 7034009..7034432 763..1186 99   Plus

RE11685.pep Sequence

Translation from 186 to 842

> RE11685.pep
MACSTNVLKGFALFWDIILALFGLVVIGLGVHIIYKFEHFNTAAFVIIAV
GVVVVLTALFGALGAARESSATSKVFVVILIVLVILEVLAVGFLWVFQTS
LLINVDKTFDKLWNDQPVPIKPGNQSQIASLERWLDCCGNVGPSDYILPP
NSCYNGESDKLNLEGCRQKFLDFIADRWTTFNLVSLVLLGVELICALLAY
VLANSIVNRWRRSKYYQK*

RE11685.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:33:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12684-PA 218 GF12684-PA 1..218 1..218 1002 84.9 Plus
Dana\GF12683-PA 220 GF12683-PA 3..220 4..215 249 29.9 Plus
Dana\GF13154-PA 226 GF13154-PA 1..226 1..215 219 26.8 Plus
Dana\GF12682-PA 227 GF12682-PA 1..227 1..215 209 28 Plus
Dana\GF12690-PA 208 GF12690-PA 1..208 1..215 187 29.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:33:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23245-PA 217 GG23245-PA 1..217 1..218 946 89.9 Plus
Dere\GG23244-PA 220 GG23244-PA 3..220 4..215 254 29.6 Plus
Dere\GG10779-PA 227 GG10779-PA 1..227 1..215 190 25.9 Plus
Dere\GG23247-PA 229 GG23247-PA 1..225 1..214 185 25 Plus
Dere\GG23240-PA 226 GG23240-PA 1..226 1..215 179 24.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:33:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21501-PA 218 GH21501-PA 1..218 1..218 850 72.9 Plus
Dgri\GH21500-PA 219 GH21500-PA 3..219 4..215 236 30.2 Plus
Dgri\GH21494-PA 226 GH21494-PA 1..226 1..215 212 26 Plus
Dgri\GH21498-PA 227 GH21498-PA 1..227 1..215 203 25.5 Plus
Dgri\GH21499-PA 230 GH21499-PA 1..230 1..215 199 28.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:00:24
Subject Length Description Subject Range Query Range Score Percent Strand
Tsp42Eg-PA 218 CG12142-PA 1..218 1..218 1125 100 Plus
Tsp42Ef-PA 220 CG12845-PA 3..220 4..215 240 27.8 Plus
Tsp42Ea-PC 226 CG18817-PC 1..226 1..215 215 24.7 Plus
Tsp42Ea-PB 226 CG18817-PB 1..226 1..215 215 24.7 Plus
Tsp42Ea-PA 226 CG18817-PA 1..226 1..215 215 24.7 Plus
Tsp42Ee-PB 228 CG10106-PB 1..228 1..215 201 26.7 Plus
Tsp42Ee-PA 228 CG10106-PA 1..228 1..215 201 26.7 Plus
Tsp42Ei-PB 229 CG12843-PB 1..224 1..213 200 23 Plus
Tsp42Ei-PA 229 CG12843-PA 1..224 1..213 200 23 Plus
Tsp42En-PB 218 CG12839-PB 1..218 1..215 199 29.5 Plus
Tsp42En-PA 218 CG12839-PA 1..218 1..215 199 29.5 Plus
Tsp42Eh-PB 231 CG12844-PB 1..230 1..216 198 25.5 Plus
Tsp42Ed-PB 227 CG12846-PB 1..227 1..215 195 25.4 Plus
Tsp42Ed-PA 227 CG12846-PA 1..227 1..215 195 25.4 Plus
lbm-PB 208 CG2374-PB 1..208 1..215 184 29.6 Plus
lbm-PA 208 CG2374-PA 1..208 1..215 184 29.6 Plus
CG30160-PA 222 CG30160-PA 1..222 1..209 179 22.9 Plus
Tsp42Eb-PB 222 CG18816-PB 1..222 1..209 179 22.9 Plus
Tsp42El-PA 217 CG12840-PA 1..217 1..215 171 28.6 Plus
Tsp42Eq-PA 219 CG12832-PA 1..218 1..215 156 22.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:33:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19471-PA 218 GI19471-PA 1..218 1..218 862 73.4 Plus
Dmoj\GI19470-PA 220 GI19470-PA 3..220 4..215 219 29.1 Plus
Dmoj\GI19464-PA 226 GI19464-PA 1..226 1..215 216 25.5 Plus
Dmoj\GI19472-PA 227 GI19472-PA 1..227 1..217 213 27.9 Plus
Dmoj\GI19473-PA 226 GI19473-PA 1..222 1..214 190 27.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:33:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11140-PA 218 GL11140-PA 1..218 1..218 907 88.5 Plus
Dper\GL11139-PA 220 GL11139-PA 3..220 4..215 254 30.5 Plus
Dper\GL11133-PA 226 GL11133-PA 1..226 1..215 213 26.4 Plus
Dper\GL11138-PA 252 GL11138-PA 81..252 46..215 205 28.4 Plus
Dper\GL11142-PA 228 GL11142-PA 1..224 1..214 202 26.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:33:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11434-PA 218 GA11434-PA 1..218 1..218 899 88.1 Plus
Dpse\GA11850-PA 220 GA11850-PA 3..220 4..215 254 30.5 Plus
Dpse\GA10076-PA 228 GA10076-PA 1..228 1..215 217 26.3 Plus
Dpse\GA15095-PA 226 GA15095-PA 1..226 1..215 213 26.4 Plus
Dpse\GA24622-PA 228 GA24622-PA 1..224 1..214 202 26.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:33:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20917-PA 218 GM20917-PA 1..218 1..218 1128 100 Plus
Dsec\GM20916-PA 220 GM20916-PA 3..220 4..215 233 28.7 Plus
Dsec\GM20912-PA 226 GM20912-PA 1..226 1..215 193 25.1 Plus
Dsec\GM20918-PA 231 GM20918-PA 1..231 1..217 193 26.3 Plus
Dsec\GM20919-PA 229 GM20919-PA 1..225 1..214 185 24.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:33:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10446-PA 218 GD10446-PA 1..218 1..218 1128 100 Plus
Dsim\GD10445-PA 225 GD10445-PA 3..225 4..215 225 29.7 Plus
Dsim\GD10441-PA 226 GD10441-PA 1..226 1..215 192 25.1 Plus
Dsim\GD10448-PA 229 GD10448-PA 1..225 1..214 190 25 Plus
Dsim\GD10280-PA 227 GD10280-PA 1..227 1..215 180 25 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:33:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15131-PA 218 GJ15131-PA 1..218 1..218 893 73.9 Plus
Dvir\GJ15134-PA 226 GJ15134-PA 1..222 1..214 217 28.5 Plus
Dvir\GJ15124-PA 226 GJ15124-PA 1..226 1..215 213 25.5 Plus
Dvir\GJ15130-PA 220 GJ15130-PA 3..220 4..215 204 31.4 Plus
Dvir\GJ15138-PA 208 GJ15138-PA 1..208 1..215 192 29.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:33:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21778-PA 218 GK21778-PA 1..218 1..218 766 77.1 Plus
Dwil\GK21777-PA 220 GK21777-PA 3..220 4..216 229 29 Plus
Dwil\GK21776-PA 228 GK21776-PA 1..228 1..215 208 27.2 Plus
Dwil\GK21771-PA 226 GK21771-PA 1..226 1..215 207 26.4 Plus
Dwil\GK21784-PA 208 GK21784-PA 1..208 1..215 199 29.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:33:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19096-PA 218 GE19096-PA 1..218 1..218 1109 96.8 Plus
Dyak\GE19095-PA 220 GE19095-PA 3..220 4..215 234 29.6 Plus
Dyak\GE19090-PA 226 GE19090-PA 1..226 1..215 198 25.1 Plus
Dyak\GE19098-PA 229 GE19098-PA 1..225 1..214 192 25.4 Plus
Dyak\Tsp42Ed-PA 227 GE24279-PA 1..227 1..215 182 25 Plus

RE11685.hyp Sequence

Translation from 186 to 842

> RE11685.hyp
MACSTNVLKGFALFWDIILALFGLVVIGLGVHIIYKFEHFNTAAFVIIAV
GVVVVLTALFGALGAARESSATSKVFVVILIVLVILEVLAVGFLWVFQTS
LLINVDKTFDKLWNDQPVPIKPGNQSQIASLERWLDCCGNVGPSDYILPP
NSCYNGESDKLNLEGCRQKFLDFIADRWTTFNLVSLVLLGVELICALLAY
VLANSIVNRWRRSKYYQK*

RE11685.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:53:46
Subject Length Description Subject Range Query Range Score Percent Strand
Tsp42Eg-PA 218 CG12142-PA 1..218 1..218 1125 100 Plus
Tsp42Ef-PA 220 CG12845-PA 3..220 4..215 240 27.8 Plus
Tsp42Ea-PC 226 CG18817-PC 1..226 1..215 215 24.7 Plus
Tsp42Ea-PB 226 CG18817-PB 1..226 1..215 215 24.7 Plus
Tsp42Ea-PA 226 CG18817-PA 1..226 1..215 215 24.7 Plus