Clone RE11768 Report

Search the DGRC for RE11768

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:117
Well:68
Vector:pFlc-1
Associated Gene/TranscriptIntS12-RA
Protein status:RE11768.pep: gold
Preliminary Size:987
Sequenced Size:1182

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5491 2001-12-12 Blastp of sequenced clone
CG5491 2002-01-01 Sim4 clustering to Release 2
CG5491 2003-01-01 Sim4 clustering to Release 3
CG5491 2008-04-29 Release 5.5 accounting
CG5491 2008-08-15 Release 5.9 accounting
CG5491 2008-12-18 5.12 accounting

Clone Sequence Records

RE11768.complete Sequence

1182 bp (1182 high quality bases) assembled on 2001-12-12

GenBank Submission: AY070574

> RE11768.complete
AAAATAAACAGCTGTTGCGCGGGCATAAACTTGCATTTATATTGTTATTT
ACTATATCTACCCGGTATTAAGATGGCCGCAAATATAGCCGCCGCTGCTG
CAGCTGCCCAAGAAGTGGATCCCGTGCTGAAGAAGGCCATCAAGTTGCTG
CACTCGAGTAATCCCACCTCGGCGGCCGAACTGCGTCTGCTTTTGGACGA
GGCTTTGAAGGCGCGTTTTGGTCCGGAGAAAAGTTTGACCAACAACATGA
CGCCACGGATGCTGGAGGATGAAGCGAACTTTTCCGGACGTGCTGCCACG
CCCCCGCAGCAGCCCATCAATGCGGACGAGATCATCAATTTGACCAACTC
ACCGGACAAGGAGCCCTCCGATTCGGTGGACACGATTGCGGATTCGGATG
ACGGTCTAAGCGCCGTGGGAATAGTTAACACCGGTGACACCGGCGACTTT
GGCGACCTCAATTGCTGCGTGTGCGGCGAGATGGTTTTCACGGCCACCAA
TCGGCTGATTGAGTGCTCCAAGTGCGGTGCCATGTACCATCAGGAGTGCC
ACAAGCCGCCCATAACCAAGGAGGAGGCGGCCGATGACCAGGAGCAGAAC
TGGCAGTGCGACACGTGCTGCAACAAGCCAACGAGCAGCGGGAGGACAAC
ATCCTCTGCAGCGGCCGTAACGCCAACTGTCTTCATAGCCGACGAACCCA
TGCCGTTGACCAGCAAAGCCAAATCGTCGGTCGCGTCGTCGCGCTCATCG
AACTCTTCCAACTCCTCGTCACCCTTCTACCGGCCCGAGCCCAGCAGTTC
CACGAATGCCAGCAGCAGTAGCAGCAGCAAGCATGGCCACAAGTCCTCCT
CTTCGTCGTCGTCCAAATCGCACAAGGAAGAACGATCCTCTAAGTCCACG
GCGGCGTCTTCTCTTAGCGCCATCGGCGGAATGGAGAAGCACAACAGCAG
TGGCACCTCATCGCGACGCAGCGGCTCCAGCACCAAATCCAGCTCCAAGA
GCAGTTCCTCCAAGCATCACGAAAGCGGCAGCAGCAGCAAGCGCAGATCC
AAGCAGTAATTTAGCATCTCTAATAATTAAGTATAAAGTTACAATCCGCA
TAAAATTCTGAACGTTCATTCATAATAATAATTCAATAATTCATTTTCAA
TAAATGATTTTTAAACAAAAAAAAAAAAAAAA

RE11768.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:48:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG5491-RA 1170 CG5491-RA 2..1165 2..1165 5805 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 14:03:00
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 22686527..22687690 2..1165 5805 99.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:34:05 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 14:02:58
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 26863399..26864562 2..1165 5805 99.9 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:14:54
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 26604230..26605393 2..1165 5805 99.9 Plus
Blast to na_te.dros performed 2019-03-15 14:02:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6726..6895 916..1076 163 60.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2311..2420 935..1040 142 63.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6736..6826 968..1059 142 66 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1508..1632 981..1103 132 63.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2328..2531 792..1004 132 56.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6723..6825 935..1045 131 64.6 Plus
Stalker 7256 Stalker STALKER 7256bp 6728..6822 1063..1155 127 62.1 Plus
HMS-Beagle 7062 HMS-Beagle Beagle 7062bp 1038..1131 1162..1070 125 60.6 Minus
Stalker4 7359 Stalker4 STALKER4 7359bp 6836..6929 1063..1155 124 63.2 Plus
HMS-Beagle 7062 HMS-Beagle Beagle 7062bp 1048..1157 1162..1055 121 60.4 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2306..2372 980..1046 119 64.2 Plus
HMS-Beagle 7062 HMS-Beagle Beagle 7062bp 1072..1158 1153..1071 119 63.2 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2346..2468 921..1040 110 59.7 Plus
gypsy11 4428 gypsy11 GYPSY11 4428bp 971..1001 800..830 110 83.9 Plus

RE11768.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 14:03:45 Download gff for RE11768.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 22686526..22687690 1..1166 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:54:21 Download gff for RE11768.complete
Subject Subject Range Query Range Percent Splice Strand
CG5491-RA 1..987 73..1059 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:17:16 Download gff for RE11768.complete
Subject Subject Range Query Range Percent Splice Strand
CG5491-RA 1..987 73..1059 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:16:25 Download gff for RE11768.complete
Subject Subject Range Query Range Percent Splice Strand
IntS12-RA 1..987 73..1059 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:43:21 Download gff for RE11768.complete
Subject Subject Range Query Range Percent Splice Strand
CG5491-RA 1..987 73..1059 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:48:24 Download gff for RE11768.complete
Subject Subject Range Query Range Percent Splice Strand
IntS12-RA 1..987 73..1059 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:49:49 Download gff for RE11768.complete
Subject Subject Range Query Range Percent Splice Strand
CG5491-RA 2..1165 2..1166 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:17:16 Download gff for RE11768.complete
Subject Subject Range Query Range Percent Splice Strand
CG5491-RA 2..1165 2..1166 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:16:25 Download gff for RE11768.complete
Subject Subject Range Query Range Percent Splice Strand
IntS12-RA 23..1184 1..1162 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:43:22 Download gff for RE11768.complete
Subject Subject Range Query Range Percent Splice Strand
CG5491-RA 2..1165 2..1166 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:48:24 Download gff for RE11768.complete
Subject Subject Range Query Range Percent Splice Strand
IntS12-RA 23..1184 1..1162 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:03:45 Download gff for RE11768.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26863398..26864562 1..1166 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:03:45 Download gff for RE11768.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26863398..26864562 1..1166 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:03:45 Download gff for RE11768.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26863398..26864562 1..1166 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:16:25 Download gff for RE11768.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 22689120..22690284 1..1166 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:19:30 Download gff for RE11768.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26604229..26605393 1..1166 99   Plus

RE11768.hyp Sequence

Translation from 0 to 1058

> RE11768.hyp
QTNSCCAGINLHLYCYLLYLPGIKMAANIAAAAAAAQEVDPVLKKAIKLL
HSSNPTSAAELRLLLDEALKARFGPEKSLTNNMTPRMLEDEANFSGRAAT
PPQQPINADEIINLTNSPDKEPSDSVDTIADSDDGLSAVGIVNTGDTGDF
GDLNCCVCGEMVFTATNRLIECSKCGAMYHQECHKPPITKEEAADDQEQN
WQCDTCCNKPTSSGRTTSSAAAVTPTVFIADEPMPLTSKAKSSVASSRSS
NSSNSSSPFYRPEPSSSTNASSSSSSKHGHKSSSSSSSKSHKEERSSKST
AASSLSAIGGMEKHNSSGTSSRRSGSSTKSSSKSSSSKHHESGSSSKRRS
KQ*

RE11768.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:14:06
Subject Length Description Subject Range Query Range Score Percent Strand
IntS12-PA 328 CG5491-PA 1..328 25..352 1665 100 Plus
PNUTS-PA 628 CG33526-PA 296..428 196..347 184 34.9 Plus
PNUTS-PB 628 CG33526-PB 296..428 196..347 184 34.9 Plus
PNUTS-PE 1135 CG33526-PE 296..428 196..347 184 34.9 Plus
PNUTS-PD 1135 CG33526-PD 296..428 196..347 184 34.9 Plus
PNUTS-PA 628 CG33526-PA 305..425 237..351 170 43 Plus
PNUTS-PB 628 CG33526-PB 305..425 237..351 170 43 Plus
PNUTS-PE 1135 CG33526-PE 305..425 237..351 170 43 Plus
PNUTS-PA 628 CG33526-PA 260..407 213..351 169 37.7 Plus
PNUTS-PB 628 CG33526-PB 260..407 213..351 169 37.7 Plus
PNUTS-PE 1135 CG33526-PE 260..407 213..351 169 37.7 Plus

RE11768.pep Sequence

Translation from 72 to 1058

> RE11768.pep
MAANIAAAAAAAQEVDPVLKKAIKLLHSSNPTSAAELRLLLDEALKARFG
PEKSLTNNMTPRMLEDEANFSGRAATPPQQPINADEIINLTNSPDKEPSD
SVDTIADSDDGLSAVGIVNTGDTGDFGDLNCCVCGEMVFTATNRLIECSK
CGAMYHQECHKPPITKEEAADDQEQNWQCDTCCNKPTSSGRTTSSAAAVT
PTVFIADEPMPLTSKAKSSVASSRSSNSSNSSSPFYRPEPSSSTNASSSS
SSKHGHKSSSSSSSKSHKEERSSKSTAASSLSAIGGMEKHNSSGTSSRRS
GSSTKSSSKSSSSKHHESGSSSKRRSKQ*

RE11768.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:34:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16457-PA 331 GF16457-PA 1..291 1..289 1024 85.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:34:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11505-PA 332 GG11505-PA 1..332 1..328 1612 95.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:34:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14241-PA 356 GH14241-PA 13..324 13..293 838 66.3 Plus
Dgri\GH14243-PA 293 GH14243-PA 2..157 55..199 532 67.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:05:23
Subject Length Description Subject Range Query Range Score Percent Strand
IntS12-PA 328 CG5491-PA 1..328 1..328 1665 100 Plus
PNUTS-PA 628 CG33526-PA 296..428 172..323 184 34.9 Plus
PNUTS-PB 628 CG33526-PB 296..428 172..323 184 34.9 Plus
PNUTS-PE 1135 CG33526-PE 296..428 172..323 184 34.9 Plus
PNUTS-PD 1135 CG33526-PD 296..428 172..323 184 34.9 Plus
Mur89F-PC 2158 CG4090-PC 294..409 213..328 175 34.5 Plus
Mur89F-PB 2159 CG4090-PB 294..409 213..328 175 34.5 Plus
PNUTS-PA 628 CG33526-PA 305..425 213..327 170 43 Plus
PNUTS-PB 628 CG33526-PB 305..425 213..327 170 43 Plus
PNUTS-PE 1135 CG33526-PE 305..425 213..327 170 43 Plus
PNUTS-PD 1135 CG33526-PD 305..425 213..327 170 43 Plus
PNUTS-PA 628 CG33526-PA 260..407 189..327 169 37.7 Plus
PNUTS-PB 628 CG33526-PB 260..407 189..327 169 37.7 Plus
PNUTS-PE 1135 CG33526-PE 260..407 189..327 169 37.7 Plus
PNUTS-PD 1135 CG33526-PD 260..407 189..327 169 37.7 Plus
Mur89F-PC 2158 CG4090-PC 272..439 165..328 162 26.8 Plus
Mur89F-PB 2159 CG4090-PB 272..439 165..328 162 26.8 Plus
BOD1-PC 1109 CG5514-PC 624..736 222..328 157 38.9 Plus
BOD1-PA 1109 CG5514-PA 624..736 222..328 157 38.9 Plus
BOD1-PD 1150 CG5514-PD 624..736 222..328 157 38.9 Plus
BOD1-PB 1150 CG5514-PB 624..736 222..328 157 38.9 Plus
BOD1-PE 1151 CG5514-PE 624..736 222..328 157 38.9 Plus
Mur89F-PC 2158 CG4090-PC 1079..1192 211..326 154 39.7 Plus
Mur89F-PB 2159 CG4090-PB 1079..1192 211..326 154 39.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:34:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22148-PA 329 GI22148-PA 13..329 13..327 903 73.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:34:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27225-PA 293 GL27225-PA 13..188 13..189 858 87 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:34:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18923-PA 340 GA18923-PA 13..295 13..292 1002 79.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:34:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10347-PA 330 GM10347-PA 1..330 1..328 1670 98.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:34:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21308-PA 330 GD21308-PA 1..330 1..328 1672 98.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:34:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24266-PA 331 GJ24266-PA 13..295 13..290 937 78.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:34:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13545-PA 334 GK13545-PA 13..293 13..294 980 80.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:34:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23694-PA 331 GE23694-PA 13..289 13..289 1199 96.8 Plus