Clone RE11908 Report

Search the DGRC for RE11908

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:119
Well:8
Vector:pFlc-1
Associated Gene/Transcriptblp-RA
Protein status:RE11908.pep: gold
Preliminary Size:426
Sequenced Size:965

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5268 2001-12-14 Blastp of sequenced clone
CG5268 2002-01-01 Sim4 clustering to Release 2
CG5268 2003-01-01 Sim4 clustering to Release 3
blp 2008-04-29 Release 5.5 accounting
blp 2008-08-15 Release 5.9 accounting
blp 2008-12-18 5.12 accounting

Clone Sequence Records

RE11908.complete Sequence

965 bp (965 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071034

> RE11908.complete
AGCGGTTTCACCTGCTTTTCGCCGCCTGCTCGTTAGTAAATATCTGGAGT
AAAAGCTAAAATTTACCTGAAGGACGCCTTTTAAATAGTACAATTGGAAC
ACGGAGGGTCACTACGGTGTTGCGTAATTAAAGCGACACGTTTTCTGAGA
CCCAAAATTAAGCTGTACACATAGAATGCCGGTGTTTTGACGTACGAATC
CAAGGAATACAAGAAACCGTCATGGCCAAGTATATCGCCCAGATCATCGT
GTTGGGCGCCCAGGCAGTGGGAAGAGCCTTTACCAAGGCGCTGCGCCAGG
AGATCGCCGCATCTCAGGAAGCAGCACGACGGGCGGGTGGTGGCAAGCAG
GGCGACAAGAGCGCCGAGTCCAACCTGCGCACAGGCATGACGCTGGAGGA
AGCCAAGCAGATCCTGAATATAGATGACCCCAAAAACGTGGACGCTATCA
CCAAGAACTACGAGCATCTGTTTCAAGTCAACGAACGCTCCAAAGGCGGC
TCCTTCTATATCCAGTCAAAGGTTTTCCGGGCGAAAGAGCGGCTGGACCA
TGAGATTAAGGCCCATGAGCAGCCGAGGTCGTCAAATACGGAAGCAGCGC
AAGATACGGCGGAGGAGTCTCAGAGCAGATCGCGGCAGCGACGCTGAGTA
TCCTTGTTGTCCCAATCGAACTAATTAGCTGATAATTGATTTAAAAACTA
CGTGTTAAGTACAAAAAATGAAAGTCTGTTGCTGTAAATAGAGATTTACG
AACATGAAGACAAGTGTAAACACTTTCTGAGAAGAGCTCGACTTTCCAGG
AACACAAATGTAATGGAATTCTTGTAAACTAACACGGATTAGCTCAGGCG
GTTAGGTATAAATATTTTACTCTCAGGCCAGGTAACTAGAATCGGATCGA
TTTTAAGATCACGCTTCTTGGGGTTTGAAAATAAAAATATTTTAAGTATC
AAAAAAAAAAAAAAA

RE11908.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:46:56
Subject Length Description Subject Range Query Range Score Percent Strand
blp-RA 1146 blp-RA 85..1040 1..956 4750 99.7 Plus
blp.a 1050 blp.a 30..982 1..956 4680 99.4 Plus
blp.b 939 blp.b 53..939 70..956 4420 99.8 Plus
blp.b 939 blp.b 18..52 1..35 160 97.1 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:08:24
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 11758964..11759532 382..950 2815 99.6 Plus
chr3R 27901430 chr3R 11758591..11758907 69..385 1570 99.7 Plus
chr3R 27901430 chr3R 11758456..11758524 1..69 330 98.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:34:08 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:08:22
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15934372..15934946 382..956 2860 99.8 Plus
3R 32079331 3R 15933999..15934315 69..385 1585 100 Plus
3R 32079331 3R 15933864..15933932 1..69 330 98.6 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:13:20
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 15675203..15675777 382..956 2860 99.8 Plus
3R 31820162 3R 15674830..15675146 69..385 1585 100 Plus
3R 31820162 3R 15674695..15674763 1..69 330 98.5 Plus
Blast to na_te.dros performed on 2019-03-15 20:08:22 has no hits.

RE11908.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:09:05 Download gff for RE11908.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 11758456..11758524 1..69 98 -> Plus
chr3R 11758592..11758906 70..384 99 -> Plus
chr3R 11758967..11759532 385..950 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:54:24 Download gff for RE11908.complete
Subject Subject Range Query Range Percent Splice Strand
blp-RA 1..426 222..647 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:14:36 Download gff for RE11908.complete
Subject Subject Range Query Range Percent Splice Strand
blp-RA 1..426 222..647 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:06:53 Download gff for RE11908.complete
Subject Subject Range Query Range Percent Splice Strand
blp-RA 1..426 222..647 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:39:53 Download gff for RE11908.complete
Subject Subject Range Query Range Percent Splice Strand
blp-RA 1..426 222..647 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:16:24 Download gff for RE11908.complete
Subject Subject Range Query Range Percent Splice Strand
blp-RA 1..426 222..647 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:46:14 Download gff for RE11908.complete
Subject Subject Range Query Range Percent Splice Strand
blp-RA 1..950 1..950 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:14:36 Download gff for RE11908.complete
Subject Subject Range Query Range Percent Splice Strand
blp-RA 1..950 1..950 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:06:53 Download gff for RE11908.complete
Subject Subject Range Query Range Percent Splice Strand
blp-RA 18..967 1..950 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:39:53 Download gff for RE11908.complete
Subject Subject Range Query Range Percent Splice Strand
blp-RA 1..950 1..950 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:16:24 Download gff for RE11908.complete
Subject Subject Range Query Range Percent Splice Strand
blp-RA 6..955 1..950 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:09:05 Download gff for RE11908.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15933864..15933932 1..69 98 -> Plus
3R 15934000..15934314 70..384 100 -> Plus
3R 15934375..15934940 385..950 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:09:05 Download gff for RE11908.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15933864..15933932 1..69 98 -> Plus
3R 15934000..15934314 70..384 100 -> Plus
3R 15934375..15934940 385..950 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:09:05 Download gff for RE11908.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15933864..15933932 1..69 98 -> Plus
3R 15934000..15934314 70..384 100 -> Plus
3R 15934375..15934940 385..950 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:06:53 Download gff for RE11908.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11759586..11759654 1..69 98 -> Plus
arm_3R 11759722..11760036 70..384 100 -> Plus
arm_3R 11760097..11760662 385..950 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:16:35 Download gff for RE11908.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15674831..15675145 70..384 100 -> Plus
3R 15675206..15675771 385..950 100   Plus
3R 15674695..15674763 1..69 98 -> Plus

RE11908.pep Sequence

Translation from 221 to 646

> RE11908.pep
MAKYIAQIIVLGAQAVGRAFTKALRQEIAASQEAARRAGGGKQGDKSAES
NLRTGMTLEEAKQILNIDDPKNVDAITKNYEHLFQVNERSKGGSFYIQSK
VFRAKERLDHEIKAHEQPRSSNTEAAQDTAEESQSRSRQRR*

RE11908.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:26:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18551-PA 142 GF18551-PA 1..139 1..140 565 83.6 Plus
Dana\GF21248-PA 148 GF21248-PA 1..121 1..121 319 53.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:26:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16964-PA 141 GG16964-PA 1..141 1..141 633 92.9 Plus
Dere\GG19662-PA 151 GG19662-PA 1..114 1..113 319 56.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:26:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23473-PA 136 GH23473-PA 1..136 1..141 526 73.9 Plus
Dgri\GH12586-PA 209 GH12586-PA 1..121 1..120 337 58.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:20:20
Subject Length Description Subject Range Query Range Score Percent Strand
blp-PB 141 CG5268-PB 1..141 1..141 698 100 Plus
blp-PA 141 CG5268-PA 1..141 1..141 698 100 Plus
CG1409-PB 150 CG1409-PB 1..117 1..116 305 55.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:26:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22953-PA 138 GI22953-PA 1..138 1..141 545 75.2 Plus
Dmoj\GI16335-PA 171 GI16335-PA 1..114 1..114 310 54.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:26:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22082-PA 137 GL22082-PA 1..137 1..141 553 78 Plus
Dper\GL14729-PA 129 GL14729-PA 1..117 1..116 268 46.2 Plus
Dper\GL14733-PA 129 GL14733-PA 1..114 1..113 265 46.5 Plus
Dper\GL14731-PA 129 GL14731-PA 1..117 1..116 265 46.2 Plus
Dper\GL14593-PA 129 GL14593-PA 1..114 1..113 235 43 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:26:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18774-PA 137 GA18774-PA 1..137 1..141 553 78 Plus
Dpse\GA26184-PA 127 GA26184-PA 1..126 1..125 273 44.4 Plus
Dpse\GA24125-PA 127 GA24125-PA 1..126 1..125 273 44.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:26:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24271-PA 141 GM24271-PA 1..141 1..141 707 96.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:26:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19059-PA 141 GD19059-PA 1..141 1..141 718 97.9 Plus
Dsim\GD16862-PA 150 GD16862-PA 1..117 1..116 327 55.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:26:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23769-PA 139 GJ23769-PA 1..139 1..141 554 76.6 Plus
Dvir\GJ15903-PA 135 GJ15903-PA 1..131 1..131 324 51.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:26:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11218-PA 135 GK11218-PA 1..135 1..141 581 78.7 Plus
Dwil\GK18836-PA 135 GK18836-PA 1..113 1..113 308 57.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:26:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24352-PA 141 GE24352-PA 1..141 1..141 634 94.3 Plus
Dyak\GE15737-PA 157 GE15737-PA 1..114 1..113 306 54.4 Plus

RE11908.hyp Sequence

Translation from 221 to 646

> RE11908.hyp
MAKYIAQIIVLGAQAVGRAFTKALRQEIAASQEAARRAGGGKQGDKSAES
NLRTGMTLEEAKQILNIDDPKNVDAITKNYEHLFQVNERSKGGSFYIQSK
VFRAKERLDHEIKAHEQPRSSNTEAAQDTAEESQSRSRQRR*

RE11908.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:08:58
Subject Length Description Subject Range Query Range Score Percent Strand
blp-PB 141 CG5268-PB 1..141 1..141 698 100 Plus
blp-PA 141 CG5268-PA 1..141 1..141 698 100 Plus
CG1409-PB 150 CG1409-PB 1..117 1..116 305 55.6 Plus