Clone RE12122 Report

Search the DGRC for RE12122

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:121
Well:22
Vector:pFlc-1
Associated Gene/TranscriptCbp20-RA
Protein status:RE12122.pep: gold
Preliminary Size:567
Sequenced Size:614

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12357 2001-12-12 Blastp of sequenced clone
CG12357 2002-01-01 Sim4 clustering to Release 2
CG12357 2003-01-01 Sim4 clustering to Release 3
Cbp20 2008-04-29 Release 5.5 accounting
Cbp20 2008-08-15 Release 5.9 accounting
Cbp20 2008-12-18 5.12 accounting

Clone Sequence Records

RE12122.complete Sequence

614 bp (614 high quality bases) assembled on 2001-12-12

GenBank Submission: AY070578

> RE12122.complete
AGTCAATAGAGTGCCGTCACTAAATAAAAGCAGAGAAAATATTTCAATAG
TTTGTAGCTGAAAAATATGTTCGCATCTGTGGAATTAAGCTCATATCGCG
ATCAGCACTTCAAGGGCTCGCGCTCCGAGCAAGAGCGATCGCTCCGCGAC
TCGTGTACACTTTACGTGGGAAACTTGAGCTTCTACACCACCGAGGAGCA
GATCCACGAGCTCTTCTCCCGCTGCGGCGATGTTCGTGTGATTGTGATGG
GCCTGGACAAGTATAAGAAGACGCCCTGCGGCTTCTGCTTCGTGGAGTAC
TATGTCCGATCGGAGGCGGAGGCGGCCATGAGATTTGTGAATGGCACTCG
CTTGGACGACCGTCTGATTCGTGTGGACTGGGACGCCGGCTTCGTGGAGG
GCAGGCAGTATGGACGCGGCAAAACCGGCGGACAGGTGCGAGATGAATAC
CGCACGGATTACGATGCCGGCCGCGGGGGTTATGGCAAACTGTTGTCACA
GAAGATTGCACCCAACACGGACAATCGCTAGTTATTAGATAAAATGACTG
TAAAGACTATAAGCCCCCCAATTAGATATTAAAGCATACCCCTTAGACTA
AAAAAAAAAAAAAA

RE12122.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:48:54
Subject Length Description Subject Range Query Range Score Percent Strand
Cbp20-RA 798 Cbp20-RA 168..765 1..598 2990 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:32:09
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 13989538..13989805 331..598 1340 100 Plus
chr3R 27901430 chr3R 13989196..13989415 113..332 1100 100 Plus
chr3R 27901430 chr3R 13989029..13989143 1..115 575 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:34:25 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:32:07
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 18165172..18165439 331..598 1340 100 Plus
3R 32079331 3R 18164830..18165049 113..332 1100 100 Plus
3R 32079331 3R 18164663..18164777 1..115 575 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:15:02
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 17906003..17906270 331..598 1340 100 Plus
3R 31820162 3R 17905661..17905880 113..332 1100 100 Plus
3R 31820162 3R 17905494..17905608 1..115 575 100 Plus
Blast to na_te.dros performed on 2019-03-15 19:32:08 has no hits.

RE12122.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:33:01 Download gff for RE12122.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 13989029..13989142 1..114 100 -> Plus
chr3R 13989198..13989415 115..332 100 -> Plus
chr3R 13989540..13989805 333..599 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:54:41 Download gff for RE12122.complete
Subject Subject Range Query Range Percent Splice Strand
Cbp20-RA 1..465 67..531 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:17:29 Download gff for RE12122.complete
Subject Subject Range Query Range Percent Splice Strand
Cbp20-RA 1..465 67..531 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:53:19 Download gff for RE12122.complete
Subject Subject Range Query Range Percent Splice Strand
Cbp20-RA 1..465 67..531 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:43:33 Download gff for RE12122.complete
Subject Subject Range Query Range Percent Splice Strand
Cbp20-RA 1..465 67..531 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:19:53 Download gff for RE12122.complete
Subject Subject Range Query Range Percent Splice Strand
Cbp20-RA 1..465 67..531 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:50:09 Download gff for RE12122.complete
Subject Subject Range Query Range Percent Splice Strand
Cbp20-RA 1..598 1..598 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:17:29 Download gff for RE12122.complete
Subject Subject Range Query Range Percent Splice Strand
Cbp20-RA 1..598 1..598 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:53:19 Download gff for RE12122.complete
Subject Subject Range Query Range Percent Splice Strand
Cbp20-RA 3..600 1..598 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:43:34 Download gff for RE12122.complete
Subject Subject Range Query Range Percent Splice Strand
Cbp20-RA 1..598 1..598 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:19:53 Download gff for RE12122.complete
Subject Subject Range Query Range Percent Splice Strand
Cbp20-RA 3..600 1..598 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:33:01 Download gff for RE12122.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18164663..18164776 1..114 100 -> Plus
3R 18164832..18165049 115..332 100 -> Plus
3R 18165174..18165439 333..599 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:33:01 Download gff for RE12122.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18164663..18164776 1..114 100 -> Plus
3R 18164832..18165049 115..332 100 -> Plus
3R 18165174..18165439 333..599 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:33:01 Download gff for RE12122.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18164663..18164776 1..114 100 -> Plus
3R 18164832..18165049 115..332 100 -> Plus
3R 18165174..18165439 333..599 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:53:19 Download gff for RE12122.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13990385..13990498 1..114 100 -> Plus
arm_3R 13990554..13990771 115..332 100 -> Plus
arm_3R 13990896..13991161 333..599 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:19:46 Download gff for RE12122.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17905663..17905880 115..332 100 -> Plus
3R 17906005..17906270 333..599 99   Plus
3R 17905494..17905607 1..114 100 -> Plus

RE12122.hyp Sequence

Translation from 66 to 530

> RE12122.hyp
MFASVELSSYRDQHFKGSRSEQERSLRDSCTLYVGNLSFYTTEEQIHELF
SRCGDVRVIVMGLDKYKKTPCGFCFVEYYVRSEAEAAMRFVNGTRLDDRL
IRVDWDAGFVEGRQYGRGKTGGQVRDEYRTDYDAGRGGYGKLLSQKIAPN
TDNR*

RE12122.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:56:19
Subject Length Description Subject Range Query Range Score Percent Strand
Cbp20-PA 154 CG12357-PA 1..154 1..154 819 100 Plus
SC35-PD 195 CG5442-PD 24..96 31..103 144 39.7 Plus
SC35-PC 195 CG5442-PC 24..96 31..103 144 39.7 Plus
SC35-PB 195 CG5442-PB 24..96 31..103 144 39.7 Plus

RE12122.pep Sequence

Translation from 66 to 530

> RE12122.pep
MFASVELSSYRDQHFKGSRSEQERSLRDSCTLYVGNLSFYTTEEQIHELF
SRCGDVRVIVMGLDKYKKTPCGFCFVEYYVRSEAEAAMRFVNGTRLDDRL
IRVDWDAGFVEGRQYGRGKTGGQVRDEYRTDYDAGRGGYGKLLSQKIAPN
TDNR*

RE12122.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:36:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16759-PA 154 GF16759-PA 1..154 1..154 783 95.5 Plus
Dana\GF16912-PA 415 GF16912-PA 6..114 22..128 146 33.9 Plus
Dana\GF15672-PA 199 GF15672-PA 20..93 30..103 144 39.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:36:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22670-PA 154 GG22670-PA 1..154 1..154 795 97.4 Plus
Dere\GG22991-PA 416 GG22991-PA 6..114 22..128 146 33.9 Plus
Dere\GG10262-PA 195 GG10262-PA 23..96 30..103 143 39.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:36:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15101-PA 154 GH15101-PA 1..154 1..154 786 95.5 Plus
Dgri\GH18352-PA 430 GH18352-PA 6..114 22..128 145 33.9 Plus
Dgri\GH11678-PA 203 GH11678-PA 23..96 30..103 144 39.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:55:15
Subject Length Description Subject Range Query Range Score Percent Strand
Cbp20-PA 154 CG12357-PA 1..154 1..154 819 100 Plus
SC35-PD 195 CG5442-PD 24..96 31..103 144 39.7 Plus
SC35-PC 195 CG5442-PC 24..96 31..103 144 39.7 Plus
SC35-PB 195 CG5442-PB 24..96 31..103 144 39.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:36:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23717-PA 154 GI23717-PA 1..154 1..154 786 95.5 Plus
Dmoj\GI23336-PA 428 GI23336-PA 6..114 22..128 146 33.9 Plus
Dmoj\GI17122-PA 203 GI17122-PA 24..97 30..103 143 39.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:36:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12592-PA 154 GL12592-PA 1..154 1..154 784 94.8 Plus
Dper\GL24357-PA 418 GL24357-PA 6..114 22..128 147 33.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:36:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11577-PA 154 GA11577-PA 1..154 1..154 784 94.8 Plus
Dpse\GA20525-PA 418 GA20525-PA 6..114 22..128 147 33.9 Plus
Dpse\GA18884-PA 207 GA18884-PA 23..96 30..103 143 39.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:36:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15280-PA 154 GM15280-PA 1..154 1..154 814 100 Plus
Dsec\GM17877-PA 419 GM17877-PA 6..114 22..128 146 33.9 Plus
Dsec\GM26218-PA 195 GM26218-PA 23..96 30..103 144 39.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:36:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19204-PA 154 GD19204-PA 1..154 1..154 814 100 Plus
Dsim\GD19237-PA 419 GD19237-PA 6..114 22..128 146 33.9 Plus
Dsim\GD22120-PA 195 GD22120-PA 23..96 30..103 144 39.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:36:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23276-PA 154 GJ23276-PA 1..154 1..154 786 95.5 Plus
Dvir\GJ18756-PA 154 GJ18756-PA 1..154 1..154 756 91.6 Plus
Dvir\GJ10336-PA 427 GJ10336-PA 6..114 22..128 146 33.9 Plus
Dvir\GJ16161-PA 202 GJ16161-PA 24..97 30..103 143 39.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:36:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11244-PA 154 GK11244-PA 1..154 1..154 783 94.8 Plus
Dwil\GK14626-PA 203 GK14626-PA 25..98 30..103 144 39.2 Plus
Dwil\GK14167-PA 401 GK14167-PA 7..115 22..128 142 33 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:36:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25514-PA 154 GE25514-PA 1..154 1..154 804 98.1 Plus
Dyak\GE25546-PA 414 GE25546-PA 6..114 22..128 146 33.9 Plus
Dyak\GE12283-PA 217 GE12283-PA 50..119 34..103 137 40 Plus