BDGP Sequence Production Resources |
Search the DGRC for RE12122
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 121 |
Well: | 22 |
Vector: | pFlc-1 |
Associated Gene/Transcript | Cbp20-RA |
Protein status: | RE12122.pep: gold |
Preliminary Size: | 567 |
Sequenced Size: | 614 |
Gene | Date | Evidence |
---|---|---|
CG12357 | 2001-12-12 | Blastp of sequenced clone |
CG12357 | 2002-01-01 | Sim4 clustering to Release 2 |
CG12357 | 2003-01-01 | Sim4 clustering to Release 3 |
Cbp20 | 2008-04-29 | Release 5.5 accounting |
Cbp20 | 2008-08-15 | Release 5.9 accounting |
Cbp20 | 2008-12-18 | 5.12 accounting |
614 bp (614 high quality bases) assembled on 2001-12-12
GenBank Submission: AY070578
> RE12122.complete AGTCAATAGAGTGCCGTCACTAAATAAAAGCAGAGAAAATATTTCAATAG TTTGTAGCTGAAAAATATGTTCGCATCTGTGGAATTAAGCTCATATCGCG ATCAGCACTTCAAGGGCTCGCGCTCCGAGCAAGAGCGATCGCTCCGCGAC TCGTGTACACTTTACGTGGGAAACTTGAGCTTCTACACCACCGAGGAGCA GATCCACGAGCTCTTCTCCCGCTGCGGCGATGTTCGTGTGATTGTGATGG GCCTGGACAAGTATAAGAAGACGCCCTGCGGCTTCTGCTTCGTGGAGTAC TATGTCCGATCGGAGGCGGAGGCGGCCATGAGATTTGTGAATGGCACTCG CTTGGACGACCGTCTGATTCGTGTGGACTGGGACGCCGGCTTCGTGGAGG GCAGGCAGTATGGACGCGGCAAAACCGGCGGACAGGTGCGAGATGAATAC CGCACGGATTACGATGCCGGCCGCGGGGGTTATGGCAAACTGTTGTCACA GAAGATTGCACCCAACACGGACAATCGCTAGTTATTAGATAAAATGACTG TAAAGACTATAAGCCCCCCAATTAGATATTAAAGCATACCCCTTAGACTA AAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Cbp20-RA | 798 | Cbp20-RA | 168..765 | 1..598 | 2990 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 13989538..13989805 | 331..598 | 1340 | 100 | Plus |
chr3R | 27901430 | chr3R | 13989196..13989415 | 113..332 | 1100 | 100 | Plus |
chr3R | 27901430 | chr3R | 13989029..13989143 | 1..115 | 575 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 18165172..18165439 | 331..598 | 1340 | 100 | Plus |
3R | 32079331 | 3R | 18164830..18165049 | 113..332 | 1100 | 100 | Plus |
3R | 32079331 | 3R | 18164663..18164777 | 1..115 | 575 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 17906003..17906270 | 331..598 | 1340 | 100 | Plus |
3R | 31820162 | 3R | 17905661..17905880 | 113..332 | 1100 | 100 | Plus |
3R | 31820162 | 3R | 17905494..17905608 | 1..115 | 575 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 13989029..13989142 | 1..114 | 100 | -> | Plus |
chr3R | 13989198..13989415 | 115..332 | 100 | -> | Plus |
chr3R | 13989540..13989805 | 333..599 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Cbp20-RA | 1..465 | 67..531 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Cbp20-RA | 1..465 | 67..531 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Cbp20-RA | 1..465 | 67..531 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Cbp20-RA | 1..465 | 67..531 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Cbp20-RA | 1..465 | 67..531 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Cbp20-RA | 1..598 | 1..598 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Cbp20-RA | 1..598 | 1..598 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Cbp20-RA | 3..600 | 1..598 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Cbp20-RA | 1..598 | 1..598 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Cbp20-RA | 3..600 | 1..598 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 18164663..18164776 | 1..114 | 100 | -> | Plus |
3R | 18164832..18165049 | 115..332 | 100 | -> | Plus |
3R | 18165174..18165439 | 333..599 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 18164663..18164776 | 1..114 | 100 | -> | Plus |
3R | 18164832..18165049 | 115..332 | 100 | -> | Plus |
3R | 18165174..18165439 | 333..599 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 18164663..18164776 | 1..114 | 100 | -> | Plus |
3R | 18164832..18165049 | 115..332 | 100 | -> | Plus |
3R | 18165174..18165439 | 333..599 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 13990385..13990498 | 1..114 | 100 | -> | Plus |
arm_3R | 13990554..13990771 | 115..332 | 100 | -> | Plus |
arm_3R | 13990896..13991161 | 333..599 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 17905663..17905880 | 115..332 | 100 | -> | Plus |
3R | 17906005..17906270 | 333..599 | 99 | Plus | |
3R | 17905494..17905607 | 1..114 | 100 | -> | Plus |
Translation from 66 to 530
> RE12122.hyp MFASVELSSYRDQHFKGSRSEQERSLRDSCTLYVGNLSFYTTEEQIHELF SRCGDVRVIVMGLDKYKKTPCGFCFVEYYVRSEAEAAMRFVNGTRLDDRL IRVDWDAGFVEGRQYGRGKTGGQVRDEYRTDYDAGRGGYGKLLSQKIAPN TDNR*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Cbp20-PA | 154 | CG12357-PA | 1..154 | 1..154 | 819 | 100 | Plus |
SC35-PD | 195 | CG5442-PD | 24..96 | 31..103 | 144 | 39.7 | Plus |
SC35-PC | 195 | CG5442-PC | 24..96 | 31..103 | 144 | 39.7 | Plus |
SC35-PB | 195 | CG5442-PB | 24..96 | 31..103 | 144 | 39.7 | Plus |
Translation from 66 to 530
> RE12122.pep MFASVELSSYRDQHFKGSRSEQERSLRDSCTLYVGNLSFYTTEEQIHELF SRCGDVRVIVMGLDKYKKTPCGFCFVEYYVRSEAEAAMRFVNGTRLDDRL IRVDWDAGFVEGRQYGRGKTGGQVRDEYRTDYDAGRGGYGKLLSQKIAPN TDNR*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF16759-PA | 154 | GF16759-PA | 1..154 | 1..154 | 783 | 95.5 | Plus |
Dana\GF16912-PA | 415 | GF16912-PA | 6..114 | 22..128 | 146 | 33.9 | Plus |
Dana\GF15672-PA | 199 | GF15672-PA | 20..93 | 30..103 | 144 | 39.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG22670-PA | 154 | GG22670-PA | 1..154 | 1..154 | 795 | 97.4 | Plus |
Dere\GG22991-PA | 416 | GG22991-PA | 6..114 | 22..128 | 146 | 33.9 | Plus |
Dere\GG10262-PA | 195 | GG10262-PA | 23..96 | 30..103 | 143 | 39.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH15101-PA | 154 | GH15101-PA | 1..154 | 1..154 | 786 | 95.5 | Plus |
Dgri\GH18352-PA | 430 | GH18352-PA | 6..114 | 22..128 | 145 | 33.9 | Plus |
Dgri\GH11678-PA | 203 | GH11678-PA | 23..96 | 30..103 | 144 | 39.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Cbp20-PA | 154 | CG12357-PA | 1..154 | 1..154 | 819 | 100 | Plus |
SC35-PD | 195 | CG5442-PD | 24..96 | 31..103 | 144 | 39.7 | Plus |
SC35-PC | 195 | CG5442-PC | 24..96 | 31..103 | 144 | 39.7 | Plus |
SC35-PB | 195 | CG5442-PB | 24..96 | 31..103 | 144 | 39.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI23717-PA | 154 | GI23717-PA | 1..154 | 1..154 | 786 | 95.5 | Plus |
Dmoj\GI23336-PA | 428 | GI23336-PA | 6..114 | 22..128 | 146 | 33.9 | Plus |
Dmoj\GI17122-PA | 203 | GI17122-PA | 24..97 | 30..103 | 143 | 39.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL12592-PA | 154 | GL12592-PA | 1..154 | 1..154 | 784 | 94.8 | Plus |
Dper\GL24357-PA | 418 | GL24357-PA | 6..114 | 22..128 | 147 | 33.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA11577-PA | 154 | GA11577-PA | 1..154 | 1..154 | 784 | 94.8 | Plus |
Dpse\GA20525-PA | 418 | GA20525-PA | 6..114 | 22..128 | 147 | 33.9 | Plus |
Dpse\GA18884-PA | 207 | GA18884-PA | 23..96 | 30..103 | 143 | 39.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM15280-PA | 154 | GM15280-PA | 1..154 | 1..154 | 814 | 100 | Plus |
Dsec\GM17877-PA | 419 | GM17877-PA | 6..114 | 22..128 | 146 | 33.9 | Plus |
Dsec\GM26218-PA | 195 | GM26218-PA | 23..96 | 30..103 | 144 | 39.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD19204-PA | 154 | GD19204-PA | 1..154 | 1..154 | 814 | 100 | Plus |
Dsim\GD19237-PA | 419 | GD19237-PA | 6..114 | 22..128 | 146 | 33.9 | Plus |
Dsim\GD22120-PA | 195 | GD22120-PA | 23..96 | 30..103 | 144 | 39.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ23276-PA | 154 | GJ23276-PA | 1..154 | 1..154 | 786 | 95.5 | Plus |
Dvir\GJ18756-PA | 154 | GJ18756-PA | 1..154 | 1..154 | 756 | 91.6 | Plus |
Dvir\GJ10336-PA | 427 | GJ10336-PA | 6..114 | 22..128 | 146 | 33.9 | Plus |
Dvir\GJ16161-PA | 202 | GJ16161-PA | 24..97 | 30..103 | 143 | 39.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK11244-PA | 154 | GK11244-PA | 1..154 | 1..154 | 783 | 94.8 | Plus |
Dwil\GK14626-PA | 203 | GK14626-PA | 25..98 | 30..103 | 144 | 39.2 | Plus |
Dwil\GK14167-PA | 401 | GK14167-PA | 7..115 | 22..128 | 142 | 33 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE25514-PA | 154 | GE25514-PA | 1..154 | 1..154 | 804 | 98.1 | Plus |
Dyak\GE25546-PA | 414 | GE25546-PA | 6..114 | 22..128 | 146 | 33.9 | Plus |
Dyak\GE12283-PA | 217 | GE12283-PA | 50..119 | 34..103 | 137 | 40 | Plus |