Clone RE12132 Report

Search the DGRC for RE12132

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:121
Well:32
Vector:pFlc-1
Associated Gene/TranscriptCG4019-RC
Protein status:RE12132.pep: gold
Sequenced Size:1144

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4019-RC 2009-06-22 Replacement based on scoring

Clone Sequence Records

RE12132.complete Sequence

1144 bp assembled on 2009-07-28

GenBank Submission: BT088979.1

> RE12132.complete
AGGTTGACATTGACAGTCGCGCTGCCGCTTTGTGAATTTTCACCAGCTAC
GGAAAAGATTGATTATATAGTGCGATCTCAAAGAATTGGACAAGTGTCAA
AATGAGCCACGAGATTCGTTGCTGTAAGGTCTTCAAAATGAAGGGATCGA
CGCTGGACAAAATCTCCGCCTTCCTCGGCGAGCTCATCGGCACCGGCATC
CTGGTCTTCCTGGGCTGCATGGGTTGCGTGAAGACGGACCTCTTTCCCAA
CAACCATCTGCAGATTGTGCTGAACTTCGGCTTCGCCGTCCTCATCGCCA
TCCAGTGCTTTGGCTGCGTCTCCGGTGCCCATCTGAATCCCGCCGTGACC
GTGGCCGCCTACATCTACGAGATGGTCACCCTGCGCATGGCATTTGCCTA
CTTCGCCGCCCAGATGCTGGGCGCCTTCATCGGCTACGGCCTGCTCATGG
TCCTGCTTCCCTCGCCCACACTTACGGTGGGCGCTGGGCTCTGCGTGACC
TTGCCCCACACCAGCGTAACCACGGGCCAGGCCCTCGGCATCGAGTTCGT
AATCACCTCCATCCTGGTCATCGTCTGCTGCGGAGTGTGGGATCCGCGCA
ACTCCAAGTTCCATGACTCCGTGGGCATTCGATTTGGCCTGGCCATCGCC
TGTCTCGCCTGCGCTGCCGGTCCCTTCACCGGCGGCAGCATGAACCCGGC
CAGGTCGTTCGCCCCCGCCCTGTGGAACAAGCACTTCGAGAGCAACTGGA
TCTACTGGCTGGCCCCGCTGAGCTCCTCCGCCATCACCGCCTACGCCTAC
AAGGTCGTCTTCCGCCGCGAGGTGGTTGAGGCGGAGATCACCTCCAATGA
GAAGCTGCGGCAACTGGAGGACGTCCAGCTGTCGTAAGGCCAAAGACATT
GCTGTAGGAAAAGCCCTAACTAATTTAGTTAATATCTAAGATGCCGAATT
TTAAAATAATGCATTCGTTGTACGCTAATGTTAGCAGTGTCTTCACAAAG
TGGCTCGAACGTTTCAAAAGGCGAACCAAGTGCACACACTTACATAAGCC
CTTGAAACGATAAACGTCTTGGTGAAAACACTAATTGCCTTCAGAAATAA
AGAACATCGAGATTTTTAATCTAAAACCAAAAAAAAAAAAAAAA

RE12132.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:32:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG4019-RC 1254 CG4019-RC 48..1181 4..1137 5655 99.9 Plus
CG4019.c 1517 CG4019.c 425..1444 118..1137 5085 99.9 Plus
CG4019-RA 1191 CG4019-RA 99..1118 118..1137 5085 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:37:20
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 19494360..19494911 669..118 2745 99.8 Minus
chr2R 21145070 chr2R 19493822..19494280 1127..669 2265 99.6 Minus
chr2R 21145070 chr2R 19495643..19495757 118..4 575 100 Minus
chr2R 21145070 chr2R 19490872..19491047 445..270 400 81.8 Minus
chr2R 21145070 chr2R 19492603..19492688 360..275 220 83.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:34:26 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:37:18
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23608131..23608682 669..118 2760 100 Minus
2R 25286936 2R 23607583..23608051 1137..669 2330 99.8 Minus
2R 25286936 2R 23609414..23609528 118..4 575 100 Minus
2R 25286936 2R 23604625..23604800 445..270 400 81.8 Minus
2R 25286936 2R 23606358..23606443 360..275 205 82.6 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:28:19
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 23609330..23609881 669..118 2760 100 Minus
2R 25260384 2R 23608782..23609250 1137..669 2330 99.7 Minus
2R 25260384 2R 23610613..23610727 118..4 575 100 Minus
2R 25260384 2R 23605824..23605999 445..270 400 81.8 Minus
2R 25260384 2R 23607557..23607642 360..275 205 82.5 Minus
Blast to na_te.dros performed on 2019-03-16 13:37:19 has no hits.

RE12132.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:38:18 Download gff for RE12132.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 19493821..19494280 669..1128 99 <- Minus
chr2R 19494361..19494910 119..668 99 <- Minus
chr2R 19495643..19495760 1..118 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:12:04 Download gff for RE12132.complete
Subject Subject Range Query Range Percent Splice Strand
CG4019-RC 1..786 102..887 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:00:41 Download gff for RE12132.complete
Subject Subject Range Query Range Percent Splice Strand
CG4019-RC 1..786 102..887 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 14:46:20 Download gff for RE12132.complete
Subject Subject Range Query Range Percent Splice Strand
CG4019-RC 1..786 102..887 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:15:28 Download gff for RE12132.complete
Subject Subject Range Query Range Percent Splice Strand
CG4019-RC 1..786 102..887 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-07-28 16:59:36 Download gff for RE12132.complete
Subject Subject Range Query Range Percent Splice Strand
CG4019-RC 1..1128 1..1128 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:00:41 Download gff for RE12132.complete
Subject Subject Range Query Range Percent Splice Strand
CG4019-RC 1..1128 1..1128 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 14:46:20 Download gff for RE12132.complete
Subject Subject Range Query Range Percent Splice Strand
CG4019-RC 11..1138 1..1128 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:15:28 Download gff for RE12132.complete
Subject Subject Range Query Range Percent Splice Strand
CG4019-RC 11..1138 1..1128 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:38:18 Download gff for RE12132.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23607592..23608051 669..1128 100 <- Minus
2R 23608132..23608681 119..668 100 <- Minus
2R 23609414..23609531 1..118 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:38:18 Download gff for RE12132.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23607592..23608051 669..1128 100 <- Minus
2R 23608132..23608681 119..668 100 <- Minus
2R 23609414..23609531 1..118 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:38:18 Download gff for RE12132.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23607592..23608051 669..1128 100 <- Minus
2R 23608132..23608681 119..668 100 <- Minus
2R 23609414..23609531 1..118 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 14:46:20 Download gff for RE12132.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19495115..19495574 669..1128 100 <- Minus
arm_2R 19495655..19496204 119..668 100 <- Minus
arm_2R 19496937..19497054 1..118 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:52:34 Download gff for RE12132.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23608809..23609268 669..1128 100 <- Minus
2R 23609349..23609898 119..668 100 <- Minus
2R 23610631..23610748 1..118 99   Minus

RE12132.pep Sequence

Translation from 101 to 886

> RE12132.pep
MSHEIRCCKVFKMKGSTLDKISAFLGELIGTGILVFLGCMGCVKTDLFPN
NHLQIVLNFGFAVLIAIQCFGCVSGAHLNPAVTVAAYIYEMVTLRMAFAY
FAAQMLGAFIGYGLLMVLLPSPTLTVGAGLCVTLPHTSVTTGQALGIEFV
ITSILVIVCCGVWDPRNSKFHDSVGIRFGLAIACLACAAGPFTGGSMNPA
RSFAPALWNKHFESNWIYWLAPLSSSAITAYAYKVVFRREVVEAEITSNE
KLRQLEDVQLS*

RE12132.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 16:18:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11830-PA 244 GF11830-PA 1..244 13..256 1047 77.5 Plus
Dana\GF11832-PA 266 GF11832-PA 10..262 8..256 708 52.2 Plus
Dana\GF11831-PA 272 GF11831-PA 29..269 21..258 647 52.3 Plus
Dana\GF13068-PA 242 GF13068-PA 12..198 25..211 310 35.6 Plus
Dana\GF12394-PA 245 GF12394-PA 26..244 24..250 307 35.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 16:18:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20010-PA 261 GG20010-PA 1..261 1..261 1283 96.2 Plus
Dere\GG20012-PA 294 GG20012-PA 42..277 13..245 730 55.5 Plus
Dere\GG20011-PA 271 GG20011-PA 8..267 2..258 635 46.5 Plus
Dere\GG22871-PA 238 GG22871-PA 14..234 27..246 315 33 Plus
Dere\GG22646-PA 245 GG22646-PA 26..244 24..250 279 33.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 16:18:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21219-PA 246 GH21219-PA 1..246 13..261 1079 81.5 Plus
Dgri\GH21221-PA 259 GH21221-PA 13..257 12..251 752 57.6 Plus
Dgri\GH21220-PA 267 GH21220-PA 15..267 9..256 638 48 Plus
Dgri\GH20503-PA 247 GH20503-PA 26..246 24..250 290 36.4 Plus
Dgri\GH20663-PA 250 GH20663-PA 12..241 25..249 271 32 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:33:03
Subject Length Description Subject Range Query Range Score Percent Strand
Eglp4-PC 261 CG4019-PC 1..261 1..261 1364 100 Plus
Eglp4-PF 297 CG4019-PF 38..297 2..261 1335 98.5 Plus
Eglp4-PE 286 CG4019-PE 32..286 7..261 1333 100 Plus
Eglp4-PB 249 CG4019-PB 1..249 13..261 1295 100 Plus
Eglp4-PD 249 CG4019-PD 1..249 13..261 1295 100 Plus
Eglp4-PA 249 CG4019-PA 1..249 13..261 1295 100 Plus
Eglp2-PA 265 CG17664-PA 18..249 18..246 712 55.6 Plus
Eglp2-PC 290 CG17664-PC 43..274 18..246 712 55.6 Plus
Eglp3-PB 270 CG17662-PB 17..267 11..258 637 47.8 Plus
Eglp1-PA 238 CG5398-PA 14..196 27..208 347 37.7 Plus
Drip-PF 278 CG9023-PF 27..254 25..260 305 33.5 Plus
Drip-PG 233 CG9023-PG 27..232 25..238 302 35.5 Plus
Drip-PE 239 CG9023-PE 21..226 25..238 302 35.5 Plus
Drip-PD 242 CG9023-PD 24..229 25..238 302 35.5 Plus
Drip-PC 243 CG9023-PC 25..230 25..238 302 35.5 Plus
Drip-PB 245 CG9023-PB 27..232 25..238 302 35.5 Plus
Drip-PA 245 CG9023-PA 27..232 25..238 302 35.5 Plus
Prip-PD 259 CG7777-PD 12..250 12..257 289 30.9 Plus
Prip-PA 264 CG7777-PA 12..250 12..257 289 30.9 Plus
Prip-PB 268 CG7777-PB 12..250 12..257 289 30.9 Plus
Prip-PC 270 CG7777-PC 12..250 12..257 289 30.9 Plus
bib-PA 696 CG4722-PA 61..277 17..237 212 27.4 Plus
bib-PB 737 CG4722-PB 61..277 17..237 212 27.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 16:18:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20504-PA 249 GI20504-PA 1..249 13..261 1039 82.3 Plus
Dmoj\GI20505-PA 274 GI20505-PA 20..274 9..258 648 48.6 Plus
Dmoj\GI20506-PA 247 GI20506-PA 6..234 14..239 574 52 Plus
Dmoj\GI21049-PA 247 GI21049-PA 26..246 24..250 300 38.2 Plus
Dmoj\GI19026-PA 242 GI19026-PA 14..241 27..253 298 33.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 16:18:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17596-PA 249 GL17596-PA 1..249 13..261 1146 85.1 Plus
Dper\GL17598-PA 266 GL17598-PA 14..264 13..256 727 54.6 Plus
Dper\GL17597-PA 272 GL17597-PA 19..271 11..260 656 49 Plus
Dper\GL21483-PA 245 GL21483-PA 3..199 18..211 322 37.7 Plus
Dper\GL18952-PA 691 GL18952-PA 98..285 53..245 183 28.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 16:18:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17871-PA 249 GA17871-PA 1..249 13..261 1144 85.1 Plus
Dpse\GA24838-PA 266 GA24838-PA 14..264 13..256 729 54.6 Plus
Dpse\GA24837-PA 273 GA24837-PA 20..272 11..260 654 49 Plus
Dpse\GA26287-PA 245 GA26287-PA 3..199 18..211 324 37.7 Plus
Dpse\GA24443-PA 244 GA24443-PA 26..240 24..245 318 36.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 16:18:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15522-PA 261 GM15522-PA 1..261 1..261 1335 96.6 Plus
Dsec\GM15524-PA 265 GM15524-PA 13..249 13..246 712 53.2 Plus
Dsec\GM15523-PA 274 GM15523-PA 8..271 2..258 618 46.2 Plus
Dsec\GM20426-PA 245 GM20426-PA 26..244 24..250 288 34.4 Plus
Dsec\GM21291-PA 264 GM21291-PA 12..250 12..257 248 30.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 16:18:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25026-PA 261 GD25026-PA 1..261 1..261 1340 96.9 Plus
Dsim\GD25028-PA 265 GD25028-PA 13..249 13..246 711 53.2 Plus
Dsim\GD25027-PA 265 GD25027-PA 8..262 2..258 620 47.9 Plus
Dsim\GD10798-PA 264 GD10798-PA 12..250 12..257 248 30.9 Plus
Dsim\GD23647-PA 674 GD23647-PA 100..288 53..256 184 28.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 16:18:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22355-PA 252 GJ22355-PA 1..222 13..234 953 80.6 Plus
Dvir\GJ22357-PA 247 GJ22357-PA 7..246 18..252 731 57.3 Plus
Dvir\GJ22356-PA 274 GJ22356-PA 142..274 128..258 331 47 Plus
Dvir\GJ19992-PA 248 GJ19992-PA 12..202 25..214 300 35.1 Plus
Dvir\GJ21971-PA 305 GJ21971-PA 84..304 24..250 284 33 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 16:18:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23174-PA 249 GK23174-PA 1..249 13..261 1063 83.5 Plus
Dwil\GK23178-PA 270 GK23178-PA 16..269 13..260 800 57.9 Plus
Dwil\GK23177-PA 262 GK23177-PA 7..257 11..258 668 49.8 Plus
Dwil\GK23175-PA 238 GK23175-PA 12..235 13..240 456 42.1 Plus
Dwil\GK21884-PA 245 GK21884-PA 26..244 24..250 302 36 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 16:18:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11546-PA 261 GE11546-PA 1..261 1..261 1337 96.2 Plus
Dyak\GE11549-PA 265 GE11549-PA 13..249 13..246 720 54 Plus
Dyak\GE11548-PA 271 GE11548-PA 17..267 11..258 626 47 Plus
Dyak\GE14309-PA 238 GE14309-PA 14..202 27..214 341 38.1 Plus
Dyak\GE13520-PA 245 GE13520-PA 26..244 24..250 293 34.4 Plus

RE12132.hyp Sequence

Translation from 101 to 886

> RE12132.hyp
MSHEIRCCKVFKMKGSTLDKISAFLGELIGTGILVFLGCMGCVKTDLFPN
NHLQIVLNFGFAVLIAIQCFGCVSGAHLNPAVTVAAYIYEMVTLRMAFAY
FAAQMLGAFIGYGLLMVLLPSPTLTVGAGLCVTLPHTSVTTGQALGIEFV
ITSILVIVCCGVWDPRNSKFHDSVGIRFGLAIACLACAAGPFTGGSMNPA
RSFAPALWNKHFESNWIYWLAPLSSSAITAYAYKVVFRREVVEAEITSNE
KLRQLEDVQLS*

RE12132.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:21:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG4019-PC 261 CG4019-PC 1..261 1..261 1364 100 Plus
CG4019-PF 297 CG4019-PF 38..297 2..261 1335 98.5 Plus
CG4019-PE 286 CG4019-PE 32..286 7..261 1333 100 Plus
CG4019-PB 249 CG4019-PB 1..249 13..261 1295 100 Plus
CG4019-PD 249 CG4019-PD 1..249 13..261 1295 100 Plus