Clone RE13370 Report

Search the DGRC for RE13370

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:133
Well:70
Vector:pFlc-1
Associated Gene/TranscriptCG11370-RA
Protein status:RE13370.pep: gold
Preliminary Size:1173
Sequenced Size:1337

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11370 2002-01-01 Sim4 clustering to Release 2
CG11370 2002-04-22 Blastp of sequenced clone
CG11370 2003-01-01 Sim4 clustering to Release 3
CG11370 2008-04-29 Release 5.5 accounting
CG11370 2008-08-15 Release 5.9 accounting
CG11370 2008-12-18 5.12 accounting

Clone Sequence Records

RE13370.complete Sequence

1337 bp (1337 high quality bases) assembled on 2002-04-22

GenBank Submission: AY113407

> RE13370.complete
ATCATTTCTTTGGTGGAAACTTCAGTGACAAGTTTAGCTCCTGCTGTGAT
CAGTGCGCCATTTCGTATCCCACAATCGAGACCCTCGCCCCCGCTATAAG
GATTTAAATCACTAGTTCTGCCCCCTCCAAAACTAAGTTCAGTCCGACAT
GAAGTTCTGTGCTGCCGTGGCTCTGCTACTGATCGCCGGCATTGTGGCCA
GCGGCGATGCCCTGCCCGCCAGGAAAAGAATGGTCTACCTCCAGCAGCCC
GCAGCAGCAGAGTGGTACGGATCCGCACCCCATCAGCGCTTCATGTATAT
GCAGTATGTCCAGCCCGGCCGCACCCACGCCCGTTCCACCCAGGCAGCCA
GTGCCCTCGTGGCCGGAGAGACCGTAGCCACCGGAACCTACCTGAAGGAT
TGCAATCACGCAGAGTCTGATACTAGCGCCGAGGGAGTCCCAGCTGACGA
TGTCCTCGCAGCCGCCGGAGCCCACGGCGCAACCTCCGTGGCCGAGGCTT
ATCCCGACCAAGCGCCAGTTGTACAGGTGGCCACCAATTCCGACGTAGCA
CCCCAAGCCGAGTCAGAGGCTGAACCCGAGCCCGAGGCCGCAGACGACGC
CGCTAAGGTTCCACGAGACTTCAACTTCGCCGCCGAGGAAGCCTCCGTCG
GCTCTGCTGCTGAGGAGGAATCAGTTCCCCTGCCCGTTGCCGAGGCCGAG
CTTCCAGCCCCCGCTCCCATTGCTCCAGTGGCCGCCGTGGTGCCAGCGAA
CCGCTACCTGCCCGCCAAGAAGAAGGTGATCGTCGAGCTGGATCAGGAGG
AGGAGGAGCCCCAGGCCGCCGCCATTGAAGACGAGGAGGAAGTAGAGAAC
GCTGTGGCCGACGACGTTGAGGAGGACGAGGAGGAGCTGTCCGTGCCCGT
AAAACCCATTAACCCTGTGCGCGTGCCCAACGCCCGTCGTCCCGCAGACA
AGAAGCCTGTGAAGGCTGCTTCTCCTGCCGGCAAGCCCTCCAAGAAGCCC
GCCGCCCCTCTGCCCGCTGGCACCTTTTTCCCAATCGATTTCGGAGGCAC
CAACGGCGGCGCCATTGCCATTGCCAACTCTTTCAGCACCGGCGAGGGCG
GATCTGCTACCAGCCACGCCATCGCATACGGCTCTCCGGAGTCCGCCGTC
CGCCGAGCCCGCCCCAATCCCAGCAAGTTCCGCCACTAATCCTTGAACCA
CACCTTGATGGCGCCAGCAACTGCGAGGGCACCCGAATCAAATCAGTCTA
AAACGATTCTCCTGTAATTATTAGCAAATTTGTCAATCTTTGAGCGCAAT
AAAATAAAGTTTTATGTTTTTAAAAAAAAAAAAAAAA

RE13370.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:13:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG11370.c 1705 CG11370.c 58..1381 1..1324 6605 99.9 Plus
CG11370-RA 1499 CG11370-RA 58..1381 1..1324 6605 99.9 Plus
CG11370.b 1690 CG11370.b 455..1366 413..1324 4560 100 Plus
CG11370.b 1690 CG11370.b 58..456 1..399 1980 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:41:12
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 22701640..22702563 398..1321 4620 100 Plus
chr3L 24539361 chr3L 22701060..22701287 1..228 1125 99.6 Plus
chr3L 24539361 chr3L 22701405..22701575 228..398 855 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:35:12 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:41:10
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 22712737..22713663 398..1324 4635 100 Plus
3L 28110227 3L 22712157..22712384 1..228 1125 99.6 Plus
3L 28110227 3L 22712502..22712672 228..398 855 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:43:44
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 22705837..22706763 398..1324 4635 100 Plus
3L 28103327 3L 22705257..22705484 1..228 1125 99.5 Plus
3L 28103327 3L 22705602..22705772 228..398 855 100 Plus
Blast to na_te.dros performed on 2019-03-16 12:41:10 has no hits.

RE13370.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:42:14 Download gff for RE13370.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 22701060..22701286 1..227 99 -> Plus
chr3L 22701405..22701575 228..398 100 -> Plus
chr3L 22701641..22702563 399..1321 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:55:20 Download gff for RE13370.complete
Subject Subject Range Query Range Percent Splice Strand
CG11370-RA 1..1041 149..1189 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:59:06 Download gff for RE13370.complete
Subject Subject Range Query Range Percent Splice Strand
CG11370-RA 1..1041 149..1189 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:37:32 Download gff for RE13370.complete
Subject Subject Range Query Range Percent Splice Strand
CG11370-RA 1..1041 149..1189 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:52:22 Download gff for RE13370.complete
Subject Subject Range Query Range Percent Splice Strand
CG11370-RA 1..1041 149..1189 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:51:20 Download gff for RE13370.complete
Subject Subject Range Query Range Percent Splice Strand
CG11370-RA 1..1041 149..1189 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:39:42 Download gff for RE13370.complete
Subject Subject Range Query Range Percent Splice Strand
CG11370-RA 1..1321 1..1321 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:59:06 Download gff for RE13370.complete
Subject Subject Range Query Range Percent Splice Strand
CG11370-RA 1..1321 1..1321 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:37:32 Download gff for RE13370.complete
Subject Subject Range Query Range Percent Splice Strand
CG11370-RA 3..1323 1..1321 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:52:22 Download gff for RE13370.complete
Subject Subject Range Query Range Percent Splice Strand
CG11370-RA 1..1321 1..1321 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:51:20 Download gff for RE13370.complete
Subject Subject Range Query Range Percent Splice Strand
CG11370-RA 3..1323 1..1321 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:42:14 Download gff for RE13370.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22712157..22712383 1..227 99 -> Plus
3L 22712502..22712672 228..398 100 -> Plus
3L 22712738..22713660 399..1321 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:42:14 Download gff for RE13370.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22712157..22712383 1..227 99 -> Plus
3L 22712502..22712672 228..398 100 -> Plus
3L 22712738..22713660 399..1321 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:42:14 Download gff for RE13370.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22712157..22712383 1..227 99 -> Plus
3L 22712502..22712672 228..398 100 -> Plus
3L 22712738..22713660 399..1321 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:37:32 Download gff for RE13370.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 22705257..22705483 1..227 99 -> Plus
arm_3L 22705602..22705772 228..398 100 -> Plus
arm_3L 22705838..22706760 399..1321 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:24:29 Download gff for RE13370.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22705257..22705483 1..227 99 -> Plus
3L 22705602..22705772 228..398 100 -> Plus
3L 22705838..22706760 399..1321 100   Plus

RE13370.pep Sequence

Translation from 148 to 1188

> RE13370.pep
MKFCAAVALLLIAGIVASGDALPARKRMVYLQQPAAAEWYGSAPHQRFMY
MQYVQPGRTHARSTQAASALVAGETVATGTYLKDCNHAESDTSAEGVPAD
DVLAAAGAHGATSVAEAYPDQAPVVQVATNSDVAPQAESEAEPEPEAADD
AAKVPRDFNFAAEEASVGSAAEEESVPLPVAEAELPAPAPIAPVAAVVPA
NRYLPAKKKVIVELDQEEEEPQAAAIEDEEEVENAVADDVEEDEEELSVP
VKPINPVRVPNARRPADKKPVKAASPAGKPSKKPAAPLPAGTFFPIDFGG
TNGGAIAIANSFSTGEGGSATSHAIAYGSPESAVRRARPNPSKFRH*

RE13370.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:30:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10992-PA 357 GF10992-PA 1..357 1..346 1340 80.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:30:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16271-PA 348 GG16271-PA 1..348 1..346 1439 94.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:30:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16710-PA 362 GH16710-PA 1..362 1..346 1019 66.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:09:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG11370-PA 346 CG11370-PA 1..346 1..346 1756 100 Plus
CG11370-PB 341 CG11370-PB 1..341 1..346 1707 98.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:30:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11397-PA 376 GI11397-PA 1..376 1..346 1012 69.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:30:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18101-PA 345 GL18101-PA 1..345 1..346 987 74.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:30:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10952-PA 345 GA10952-PA 1..345 1..346 989 74.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:30:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22465-PA 340 GM22465-PA 1..340 1..346 1671 96.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:30:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15047-PA 264 GD15047-PA 1..264 1..270 948 93 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:30:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11658-PA 341 GJ11658-PA 1..341 1..346 1085 73.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:30:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16771-PA 356 GK16771-PA 1..356 1..346 1160 73.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:30:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22632-PA 345 GE22632-PA 1..345 1..346 1450 92.2 Plus
Dyak\GE22630-PA 214 GE22630-PA 17..214 150..346 692 91.4 Plus

RE13370.hyp Sequence

Translation from 148 to 1188

> RE13370.hyp
MKFCAAVALLLIAGIVASGDALPARKRMVYLQQPAAAEWYGSAPHQRFMY
MQYVQPGRTHARSTQAASALVAGETVATGTYLKDCNHAESDTSAEGVPAD
DVLAAAGAHGATSVAEAYPDQAPVVQVATNSDVAPQAESEAEPEPEAADD
AAKVPRDFNFAAEEASVGSAAEEESVPLPVAEAELPAPAPIAPVAAVVPA
NRYLPAKKKVIVELDQEEEEPQAAAIEDEEEVENAVADDVEEDEEELSVP
VKPINPVRVPNARRPADKKPVKAASPAGKPSKKPAAPLPAGTFFPIDFGG
TNGGAIAIANSFSTGEGGSATSHAIAYGSPESAVRRARPNPSKFRH*

RE13370.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:25:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG11370-PA 346 CG11370-PA 1..346 1..346 1756 100 Plus
CG11370-PB 341 CG11370-PB 1..341 1..346 1707 98.6 Plus