Clone RE13652 Report

Search the DGRC for RE13652

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:136
Well:52
Vector:pFlc-1
Associated Gene/TranscriptCG12534-RA
Protein status:RE13652.pep: validated full length
Preliminary Size:786
Sequenced Size:1088

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12534 2002-01-01 Sim4 clustering to Release 2
CG12534 2002-03-20 Blastp of sequenced clone
CG12534 2003-01-01 Sim4 clustering to Release 3
CG12534 2008-04-29 Release 5.5 accounting
CG12534 2008-08-15 Release 5.9 accounting
CG12534 2008-12-18 5.12 accounting

Clone Sequence Records

RE13652.complete Sequence

1088 bp (1088 high quality bases) assembled on 2002-03-20

GenBank Submission: AY094854

> RE13652.complete
AAGATTCTAGAACTACCCACCACACCAACGCTTCTGCTGCGCCGCCAGTC
CCACAACTACGGCTACGACTACATCAGCCCCACGCACATCGAACTCAGCC
GGGAAGCAACTCGCCTGGTAATTCGCCGTCTGCAGCGCACCGTTCTCCGC
CTGATCCGTGACCCGGACTTCATCATGTCTGCCGAGGCGAATCCCGAGAT
GGATAAGGAGCACCACGAGTCCCCATTCGCAGCGAACCGCAAGGCCGGTG
CCAGCGGCGCCGGCAAACAGGACTCGAACTGCCGCACCTGCAACGATTTC
AAGTCGTGGTCCAAGCAGCAACGCCTCATCTCCAACGTGCAGAGCGCCAA
GGTGAAGCACATGGCCGCCGCCGAAAAGCTGACCGTCAACGCCGCCGAAG
ATCCGCTGCCCCGCGACGACTGCCCGCTGGACAAGGTGAGGCTGGGAATT
TCCACCTGGGGACTGCTCCACACCATGGCCGCCTTTTACTCGGACAACCC
CACGGACACCGAGAAGCGCGACATGAAGACCTTTTTTGAGGTTCTGTCGC
GCCTTTACCCCTGCGAGTTTTGCGCCAAGGACTTTCGCACCGACCTGGAC
GTCAACCCCATCAATGTGAACTCCCAAAAGGAGCTAGCACTGTGGCTGTG
CAAGTTCCACAACCGAGTGAACGACAAACTGGGCAAACCGCTCTTCGATT
GCACCAAGGTGAACGAGAGGTGGCGCGACGGCTGGCTAGACGGCTCCTGC
GACTAGGCGCCGCAGCTAACCAGCGCCGAGAAGCCCCGTCTCCCGCCCGT
TGCAGGTTGCCATGTTGACCAGACTTTGTCCCACATTTTGCTCGGCTGGC
CCACAACTACAACCACGGAACACGGGACTCCTGCTCGGCGGTGTACCGCC
GCCAACCCGAAACTGTGCCCTGTTTCTGGCCAGAGGCCATGCCCACCAGT
CGGAACCTGCGTCAGCGTGACATTAAATTGAGTTATGTTGTAATAGAGCG
ACACATCGAAGGTCCATTGTTAAATGATTTGCTGGCTATGAACTCCATTA
GAATATACACATTATGTTGAGGAAAAAAAAAAAAAAAA

RE13652.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:20:09
Subject Length Description Subject Range Query Range Score Percent Strand
Alr-RA 1343 Alr-RA 65..1137 1..1073 5365 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:09:20
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 19638400..19638878 594..1072 2395 100 Plus
chrX 22417052 chrX 19637669..19638023 1..355 1775 100 Plus
chrX 22417052 chrX 19638097..19638340 350..593 1220 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:35:31 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:09:18
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 19749689..19750168 594..1073 2400 100 Plus
X 23542271 X 19748958..19749312 1..355 1775 100 Plus
X 23542271 X 19749386..19749629 350..593 1220 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:49:40
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 19757787..19758266 594..1073 2400 100 Plus
X 23527363 X 19757056..19757410 1..355 1775 100 Plus
X 23527363 X 19757484..19757727 350..593 1220 100 Plus
Blast to na_te.dros performed on 2019-03-16 03:09:18 has no hits.

RE13652.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:10:35 Download gff for RE13652.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 19637669..19638019 1..351 100 -> Plus
chrX 19638099..19638340 352..593 100 -> Plus
chrX 19638400..19638878 594..1072 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:55:36 Download gff for RE13652.complete
Subject Subject Range Query Range Percent Splice Strand
CG12534-RA 31..786 1..756 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:26:19 Download gff for RE13652.complete
Subject Subject Range Query Range Percent Splice Strand
Alr-RA 31..786 1..756 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:42:38 Download gff for RE13652.complete
Subject Subject Range Query Range Percent Splice Strand
Alr-RA 31..786 1..756 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:01:32 Download gff for RE13652.complete
Subject Subject Range Query Range Percent Splice Strand
CG12534-RA 31..786 1..756 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:32:20 Download gff for RE13652.complete
Subject Subject Range Query Range Percent Splice Strand
Alr-RA 31..786 1..756 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:52:52 Download gff for RE13652.complete
Subject Subject Range Query Range Percent Splice Strand
CG12534-RA 40..1111 1..1072 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:26:19 Download gff for RE13652.complete
Subject Subject Range Query Range Percent Splice Strand
Alr-RA 40..1111 1..1072 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:42:38 Download gff for RE13652.complete
Subject Subject Range Query Range Percent Splice Strand
Alr-RA 36..1107 1..1072 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:01:32 Download gff for RE13652.complete
Subject Subject Range Query Range Percent Splice Strand
CG12534-RA 40..1111 1..1072 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:32:20 Download gff for RE13652.complete
Subject Subject Range Query Range Percent Splice Strand
Alr-RA 36..1107 1..1072 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:10:35 Download gff for RE13652.complete
Subject Subject Range Query Range Percent Splice Strand
X 19748958..19749308 1..351 100 -> Plus
X 19749388..19749629 352..593 100 -> Plus
X 19749689..19750167 594..1072 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:10:35 Download gff for RE13652.complete
Subject Subject Range Query Range Percent Splice Strand
X 19748958..19749308 1..351 100 -> Plus
X 19749388..19749629 352..593 100 -> Plus
X 19749689..19750167 594..1072 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:10:35 Download gff for RE13652.complete
Subject Subject Range Query Range Percent Splice Strand
X 19748958..19749308 1..351 100 -> Plus
X 19749388..19749629 352..593 100 -> Plus
X 19749689..19750167 594..1072 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:42:38 Download gff for RE13652.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 19643421..19643662 352..593 100 -> Plus
arm_X 19642991..19643341 1..351 100 -> Plus
arm_X 19643722..19644200 594..1072 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:34:42 Download gff for RE13652.complete
Subject Subject Range Query Range Percent Splice Strand
X 19757056..19757406 1..351 100 -> Plus
X 19757486..19757727 352..593 100 -> Plus
X 19757787..19758265 594..1072 100   Plus

RE13652.hyp Sequence

Translation from 0 to 755

> RE13652.hyp
KILELPTTPTLLLRRQSHNYGYDYISPTHIELSREATRLVIRRLQRTVLR
LIRDPDFIMSAEANPEMDKEHHESPFAANRKAGASGAGKQDSNCRTCNDF
KSWSKQQRLISNVQSAKVKHMAAAEKLTVNAAEDPLPRDDCPLDKVRLGI
STWGLLHTMAAFYSDNPTDTEKRDMKTFFEVLSRLYPCEFCAKDFRTDLD
VNPINVNSQKELALWLCKFHNRVNDKLGKPLFDCTKVNERWRDGWLDGSC
D*

RE13652.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:02:15
Subject Length Description Subject Range Query Range Score Percent Strand
Alr-PA 261 CG12534-PA 11..261 1..251 1348 100 Plus
Alr-PB 266 CG12534-PB 16..266 1..251 1348 100 Plus

RE13652.pep Sequence

Translation from 174 to 755

> RE13652.pep
MSAEANPEMDKEHHESPFAANRKAGASGAGKQDSNCRTCNDFKSWSKQQR
LISNVQSAKVKHMAAAEKLTVNAAEDPLPRDDCPLDKVRLGISTWGLLHT
MAAFYSDNPTDTEKRDMKTFFEVLSRLYPCEFCAKDFRTDLDVNPINVNS
QKELALWLCKFHNRVNDKLGKPLFDCTKVNERWRDGWLDGSCD*

RE13652.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:53:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20218-PA 275 GF20218-PA 103..275 15..193 839 87.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:53:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19256-PA 265 GG19256-PA 74..265 1..193 995 95.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:53:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18034-PA 190 GH18034-PA 21..190 21..193 762 79.8 Plus
Dgri\GH17696-PA 288 GH17696-PA 14..176 15..179 611 71.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:10:18
Subject Length Description Subject Range Query Range Score Percent Strand
Alr-PA 261 CG12534-PA 69..261 1..193 1054 100 Plus
Alr-PB 266 CG12534-PB 74..266 1..193 1054 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:53:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16104-PA 191 GI16104-PA 28..191 30..193 798 87.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:53:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15019-PA 185 GL15019-PA 1..185 1..193 801 79.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:53:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11683-PA 185 GA11683-PA 1..185 1..193 801 79.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:53:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22993-PA 265 GM22993-PA 74..265 1..193 1017 98.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:53:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17467-PA 192 GD17467-PA 1..192 1..193 1007 98.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:53:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15753-PA 190 GJ15753-PA 11..190 3..193 800 80.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:53:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25283-PA 191 GK25283-PA 13..191 14..193 805 83.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:53:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15875-PA 267 GE15875-PA 74..267 1..193 1011 97.4 Plus