Clone RE13669 Report

Search the DGRC for RE13669

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:136
Well:69
Vector:pFlc-1
Associated Gene/TranscriptCG13983-RA
Protein status:RE13669.pep: gold
Preliminary Size:762
Sequenced Size:890

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13983 2002-01-01 Sim4 clustering to Release 2
CG13983 2002-03-20 Blastp of sequenced clone
CG13983 2003-01-01 Sim4 clustering to Release 3
CG13983 2008-04-29 Release 5.5 accounting
CG13983 2008-08-15 Release 5.9 accounting
CG13983 2008-12-18 5.12 accounting

Clone Sequence Records

RE13669.complete Sequence

890 bp (890 high quality bases) assembled on 2002-03-20

GenBank Submission: AY094855

> RE13669.complete
ACAGTCATCTCCAGCAGCTATCGATTGACATACCATGAGAACCCTGAGCG
TCTTGATTCTCCTCGCCACTCTGGTTGCCTTTTGTGCAGCCCAGCAGGCC
TCCAACGGCAAGAACAGAAAGGAAAATGCCTTCTCCAAGATCGTTCCTCG
CCTGCTGTGGAACATCAAGCGCGGCGACCAGGAGAGCCACCGCAACTCCC
AGCAGCCCATCATCATAGTGCAGCAGCCCAGCTCGAATCAGGAATCGGAT
AGACACCACCACCACAACCCCAACTATCCCTACTACCCGTACTACCCACC
ACCACCACCTCAAAACCGTCCTCCGCCACCGTTTCCCGGCATGGACTGGA
ACACTGTGGGAGGAGGCCCCACCTACCTGATCATCAACCCCAACAACATG
CAGGGCATCTACCTGCCCGCCAGCTCTAACAGCTCCAACTCCACTAGCTC
ACGGCGCAGCGCCTTCGTGCCCACCATTTCCGATTTGCTGCAGGGCCTCA
ACCTGGACGACCTGGCCGATGGAAGTCTCTTCGAGGATGATTCCGAGGTG
GTCAACGCGGCCGAGGATGGAAATGCGGAGATTCCCCTGGCCGATGGACC
AATCAGCCAGGCTGACGATGATCGCGAGGAGGACGTGATCAGCGAGGACG
AGATCGATGCCATGGATCGCCAGAGCAACAGGGGATTGAGTCCCAAGCAT
CTGGTCTCCATACTGATGCAGGACAAGCGACGTCGCCGCATCCAGGAGGT
TCTCGCTGGCATCTATCTGAGGAACTACAATCTGAACAGAAAGTAATCGA
ACGGATACGAGCAGATACAAATTGAAATTGTGCGAGGCTGAATAAATAGC
GGGCACCTTGCCCAAAAACACCCCAAAAAAAAAAAAAAAA

RE13669.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:20:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG13983-RA 1078 CG13983-RA 102..980 1..879 4380 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:56:01
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 6262607..6263353 874..128 3735 100 Minus
chr2L 23010047 chr2L 6263410..6263537 128..1 640 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:35:33 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:55:59
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 6263552..6264303 879..128 3745 99.9 Minus
2L 23513712 2L 6264360..6264487 128..1 640 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:49:41
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 6263552..6264303 879..128 3745 99.8 Minus
2L 23513712 2L 6264360..6264487 128..1 640 100 Minus
Blast to na_te.dros performed on 2019-03-16 20:56:00 has no hits.

RE13669.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:56:47 Download gff for RE13669.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 6262607..6263171 310..874 100 == Minus
chr2L 6263228..6263352 129..253 100 <- Minus
chr2L 6263410..6263537 1..128 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:55:38 Download gff for RE13669.complete
Subject Subject Range Query Range Percent Splice Strand
CG13983-RA 1..762 35..796 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:26:21 Download gff for RE13669.complete
Subject Subject Range Query Range Percent Splice Strand
CG13983-RA 1..762 35..796 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:30:35 Download gff for RE13669.complete
Subject Subject Range Query Range Percent Splice Strand
CG13983-RA 1..762 35..796 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:01:33 Download gff for RE13669.complete
Subject Subject Range Query Range Percent Splice Strand
CG13983-RA 1..762 35..796 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:59:54 Download gff for RE13669.complete
Subject Subject Range Query Range Percent Splice Strand
CG13983-RA 1..762 35..796 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:52:54 Download gff for RE13669.complete
Subject Subject Range Query Range Percent Splice Strand
CG13983-RA 1..874 1..874 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:26:21 Download gff for RE13669.complete
Subject Subject Range Query Range Percent Splice Strand
CG13983-RA 1..874 1..874 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:30:35 Download gff for RE13669.complete
Subject Subject Range Query Range Percent Splice Strand
CG13983-RA 4..877 1..874 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:01:33 Download gff for RE13669.complete
Subject Subject Range Query Range Percent Splice Strand
CG13983-RA 1..874 1..874 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:59:54 Download gff for RE13669.complete
Subject Subject Range Query Range Percent Splice Strand
CG13983-RA 4..877 1..874 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:56:47 Download gff for RE13669.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6263557..6264302 129..874 100 <- Minus
2L 6264360..6264487 1..128 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:56:47 Download gff for RE13669.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6263557..6264302 129..874 100 <- Minus
2L 6264360..6264487 1..128 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:56:47 Download gff for RE13669.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6263557..6264302 129..874 100 <- Minus
2L 6264360..6264487 1..128 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:30:35 Download gff for RE13669.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 6263557..6264302 129..874 100 <- Minus
arm_2L 6264360..6264487 1..128 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:34:44 Download gff for RE13669.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6263557..6264302 129..874 100 <- Minus
2L 6264360..6264487 1..128 100   Minus

RE13669.pep Sequence

Translation from 34 to 795

> RE13669.pep
MRTLSVLILLATLVAFCAAQQASNGKNRKENAFSKIVPRLLWNIKRGDQE
SHRNSQQPIIIVQQPSSNQESDRHHHHNPNYPYYPYYPPPPPQNRPPPPF
PGMDWNTVGGGPTYLIINPNNMQGIYLPASSNSSNSTSSRRSAFVPTISD
LLQGLNLDDLADGSLFEDDSEVVNAAEDGNAEIPLADGPISQADDDREED
VISEDEIDAMDRQSNRGLSPKHLVSILMQDKRRRRIQEVLAGIYLRNYNL
NRK*

RE13669.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:53:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15398-PA 262 GF15398-PA 5..262 1..253 734 65.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:53:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23634-PA 253 GG23634-PA 1..253 1..253 935 87 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:53:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10998-PA 263 GH10998-PA 5..263 3..253 267 37.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:20:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG13983-PA 253 CG13983-PA 1..253 1..253 1332 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:53:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17515-PA 254 GI17515-PA 9..254 7..253 240 36.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:53:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26280-PA 263 GL26280-PA 1..263 1..253 636 63.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:53:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12674-PA 263 GA12674-PA 1..263 1..253 626 62.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:53:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17952-PA 253 GM17952-PA 1..253 1..253 1301 96.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:53:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22591-PA 253 GD22591-PA 1..253 1..253 997 93.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:53:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15290-PA 250 GJ15290-PA 5..250 3..253 308 46.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:53:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15372-PA 247 GK15372-PA 5..247 4..253 510 51.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:53:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18455-PA 254 GE18455-PA 1..254 1..253 1042 92.1 Plus

RE13669.hyp Sequence

Translation from 34 to 795

> RE13669.hyp
MRTLSVLILLATLVAFCAAQQASNGKNRKENAFSKIVPRLLWNIKRGDQE
SHRNSQQPIIIVQQPSSNQESDRHHHHNPNYPYYPYYPPPPPQNRPPPPF
PGMDWNTVGGGPTYLIINPNNMQGIYLPASSNSSNSTSSRRSAFVPTISD
LLQGLNLDDLADGSLFEDDSEVVNAAEDGNAEIPLADGPISQADDDREED
VISEDEIDAMDRQSNRGLSPKHLVSILMQDKRRRRIQEVLAGIYLRNYNL
NRK*

RE13669.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:43:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG13983-PA 253 CG13983-PA 1..253 1..253 1332 100 Plus