BDGP Sequence Production Resources |
Search the DGRC for RE13747
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 137 |
Well: | 47 |
Vector: | pFlc-1 |
Associated Gene/Transcript | Dim1-RA |
Protein status: | RE13747.pep: gold |
Preliminary Size: | 420 |
Sequenced Size: | 618 |
Gene | Date | Evidence |
---|---|---|
CG3058 | 2001-12-14 | Blastp of sequenced clone |
CG3058 | 2002-01-01 | Sim4 clustering to Release 2 |
CG3058 | 2003-01-01 | Sim4 clustering to Release 3 |
Dim1 | 2008-04-29 | Release 5.5 accounting |
Dim1 | 2008-08-15 | Release 5.9 accounting |
Dim1 | 2008-12-18 | 5.12 accounting |
618 bp (618 high quality bases) assembled on 2001-12-14
GenBank Submission: AY071048
> RE13747.complete ATTGTTAGTACATCACTATTTTGTGAGACTTTGTTTATGTTTTAATTTTT CTGCGGTAACTTGAAATAAAAAACGCGCCAGGATGTCGTATATGCTCCCT CATTTGCACAATGGCTGGCAGGTGGACCAGGCCATTCTCTCCGAGGAGGA CCGAGTAGTTGTAATACGTTTCGGTCACGATTGGGACCCCGCCTGCATGA AAATGGATGAGGTCATGTACAGCATCGCCGAGAAGGTGAAGAACTTTGCT GTCATCTATTTGGTGGACATTACCGAGGTGCCGGACTTCAACAAGATGTA CGAGTTGTACGATCCTTGCACGGTGATGTTCTTCTTCCGCAACAAGCACA TCATGATCGATTTGGGCACGGGCAACAACAACAAGATCAACTGGCCACTG GAGGACAAGCAGGAGATGATCGACATTGTGGAAACGGTGTATCGAGGTGC CCGTAAGGGCCGTGGTCTGGTAGTCTCGCCCAAGGACTACTCTACCAAGT ACAGATACTAAGGTGGGTCGCGTACCCCGCCGACTTAGTTTAATGTATCC CATTTAGGCGTAACAAATTGATGATCCCAAATAGAAGCGACTGTCTCTTG GCAAAAAAAAAAAAAAAA
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 4402394..4402553 | 1..160 | 100 | -> | Plus |
chr2L | 4402653..4403094 | 161..602 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Dim1-RA | 1..429 | 83..511 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Dim1-RA | 1..429 | 83..511 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Dim1-RA | 1..429 | 83..511 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Dim1-RA | 1..429 | 83..511 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Dim1-RA | 1..429 | 83..511 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Dim1-RA | 1..602 | 1..602 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Dim1-RA | 1..602 | 1..602 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Dim1-RA | 5..606 | 1..602 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Dim1-RA | 1..602 | 1..602 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Dim1-RA | 5..606 | 1..602 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 4403255..4403414 | 1..160 | 100 | -> | Plus |
2L | 4403514..4403955 | 161..602 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 4403255..4403414 | 1..160 | 100 | -> | Plus |
2L | 4403514..4403955 | 161..602 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 4403255..4403414 | 1..160 | 100 | -> | Plus |
2L | 4403514..4403955 | 161..602 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 4403255..4403414 | 1..160 | 100 | -> | Plus |
arm_2L | 4403514..4403955 | 161..602 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 4403514..4403955 | 161..602 | 100 | Plus | |
2L | 4403255..4403414 | 1..160 | 100 | -> | Plus |
Translation from 82 to 510
> RE13747.hyp MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPACMKMDEVMYSIAE KVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNN KINWPLEDKQEMIDIVETVYRGARKGRGLVVSPKDYSTKYRY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dim1-PA | 142 | CG3058-PA | 1..142 | 1..142 | 769 | 100 | Plus |
Translation from 82 to 510
> RE13747.pep MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPACMKMDEVMYSIAE KVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNN KINWPLEDKQEMIDIVETVYRGARKGRGLVVSPKDYSTKYRY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF21189-PA | 142 | GF21189-PA | 1..142 | 1..142 | 763 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG25001-PA | 142 | GG25001-PA | 1..142 | 1..142 | 763 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH10125-PA | 142 | GH10125-PA | 1..142 | 1..142 | 763 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dim1-PA | 142 | CG3058-PA | 1..142 | 1..142 | 769 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI22095-PA | 142 | GI22095-PA | 1..142 | 1..142 | 763 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL15133-PA | 142 | GL15133-PA | 1..142 | 1..142 | 763 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA15896-PA | 142 | GA15896-PA | 1..142 | 1..142 | 763 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM18471-PA | 142 | GM18471-PA | 1..142 | 1..142 | 763 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD23285-PA | 147 | GD23285-PA | 1..138 | 1..138 | 742 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ19964-PA | 142 | GJ19964-PA | 1..142 | 1..142 | 763 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK24348-PA | 142 | GK24348-PA | 1..142 | 1..142 | 763 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE18287-PA | 142 | GE18287-PA | 1..142 | 1..142 | 763 | 100 | Plus |