Clone RE13747 Report

Search the DGRC for RE13747

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:137
Well:47
Vector:pFlc-1
Associated Gene/TranscriptDim1-RA
Protein status:RE13747.pep: gold
Preliminary Size:420
Sequenced Size:618

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3058 2001-12-14 Blastp of sequenced clone
CG3058 2002-01-01 Sim4 clustering to Release 2
CG3058 2003-01-01 Sim4 clustering to Release 3
Dim1 2008-04-29 Release 5.5 accounting
Dim1 2008-08-15 Release 5.9 accounting
Dim1 2008-12-18 5.12 accounting

Clone Sequence Records

RE13747.complete Sequence

618 bp (618 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071048

> RE13747.complete
ATTGTTAGTACATCACTATTTTGTGAGACTTTGTTTATGTTTTAATTTTT
CTGCGGTAACTTGAAATAAAAAACGCGCCAGGATGTCGTATATGCTCCCT
CATTTGCACAATGGCTGGCAGGTGGACCAGGCCATTCTCTCCGAGGAGGA
CCGAGTAGTTGTAATACGTTTCGGTCACGATTGGGACCCCGCCTGCATGA
AAATGGATGAGGTCATGTACAGCATCGCCGAGAAGGTGAAGAACTTTGCT
GTCATCTATTTGGTGGACATTACCGAGGTGCCGGACTTCAACAAGATGTA
CGAGTTGTACGATCCTTGCACGGTGATGTTCTTCTTCCGCAACAAGCACA
TCATGATCGATTTGGGCACGGGCAACAACAACAAGATCAACTGGCCACTG
GAGGACAAGCAGGAGATGATCGACATTGTGGAAACGGTGTATCGAGGTGC
CCGTAAGGGCCGTGGTCTGGTAGTCTCGCCCAAGGACTACTCTACCAAGT
ACAGATACTAAGGTGGGTCGCGTACCCCGCCGACTTAGTTTAATGTATCC
CATTTAGGCGTAACAAATTGATGATCCCAAATAGAAGCGACTGTCTCTTG
GCAAAAAAAAAAAAAAAA

RE13747.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:34:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dim1-RA 769 Dim1-RA 11..614 1..604 3020 100 Plus
Dim1.a 1985 Dim1.a 11..614 1..604 3020 100 Plus
Dim1.b 1383 Dim1.b 11..614 1..604 3020 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:09:22
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 4402653..4403094 161..602 2210 100 Plus
chr2L 23010047 chr2L 4402394..4402555 1..162 810 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:35:34 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:09:20
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4403514..4403957 161..604 2220 100 Plus
2L 23513712 2L 4403255..4403416 1..162 810 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:09:08
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4403514..4403957 161..604 2220 100 Plus
2L 23513712 2L 4403255..4403416 1..162 810 100 Plus
Blast to na_te.dros performed on 2019-03-16 03:09:21 has no hits.

RE13747.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:10:36 Download gff for RE13747.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 4402394..4402553 1..160 100 -> Plus
chr2L 4402653..4403094 161..602 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:55:39 Download gff for RE13747.complete
Subject Subject Range Query Range Percent Splice Strand
Dim1-RA 1..429 83..511 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:05:29 Download gff for RE13747.complete
Subject Subject Range Query Range Percent Splice Strand
Dim1-RA 1..429 83..511 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:42:40 Download gff for RE13747.complete
Subject Subject Range Query Range Percent Splice Strand
Dim1-RA 1..429 83..511 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:55:32 Download gff for RE13747.complete
Subject Subject Range Query Range Percent Splice Strand
Dim1-RA 1..429 83..511 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:32:24 Download gff for RE13747.complete
Subject Subject Range Query Range Percent Splice Strand
Dim1-RA 1..429 83..511 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:24:56 Download gff for RE13747.complete
Subject Subject Range Query Range Percent Splice Strand
Dim1-RA 1..602 1..602 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:05:29 Download gff for RE13747.complete
Subject Subject Range Query Range Percent Splice Strand
Dim1-RA 1..602 1..602 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:42:40 Download gff for RE13747.complete
Subject Subject Range Query Range Percent Splice Strand
Dim1-RA 5..606 1..602 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:55:32 Download gff for RE13747.complete
Subject Subject Range Query Range Percent Splice Strand
Dim1-RA 1..602 1..602 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:32:24 Download gff for RE13747.complete
Subject Subject Range Query Range Percent Splice Strand
Dim1-RA 5..606 1..602 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:10:36 Download gff for RE13747.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4403255..4403414 1..160 100 -> Plus
2L 4403514..4403955 161..602 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:10:36 Download gff for RE13747.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4403255..4403414 1..160 100 -> Plus
2L 4403514..4403955 161..602 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:10:36 Download gff for RE13747.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4403255..4403414 1..160 100 -> Plus
2L 4403514..4403955 161..602 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:42:40 Download gff for RE13747.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 4403255..4403414 1..160 100 -> Plus
arm_2L 4403514..4403955 161..602 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:27:53 Download gff for RE13747.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4403514..4403955 161..602 100   Plus
2L 4403255..4403414 1..160 100 -> Plus

RE13747.hyp Sequence

Translation from 82 to 510

> RE13747.hyp
MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPACMKMDEVMYSIAE
KVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNN
KINWPLEDKQEMIDIVETVYRGARKGRGLVVSPKDYSTKYRY*

RE13747.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:15:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dim1-PA 142 CG3058-PA 1..142 1..142 769 100 Plus

RE13747.pep Sequence

Translation from 82 to 510

> RE13747.pep
MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPACMKMDEVMYSIAE
KVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNN
KINWPLEDKQEMIDIVETVYRGARKGRGLVVSPKDYSTKYRY*

RE13747.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 07:19:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21189-PA 142 GF21189-PA 1..142 1..142 763 100 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 07:19:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25001-PA 142 GG25001-PA 1..142 1..142 763 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 07:19:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10125-PA 142 GH10125-PA 1..142 1..142 763 100 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:25:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dim1-PA 142 CG3058-PA 1..142 1..142 769 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 07:19:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22095-PA 142 GI22095-PA 1..142 1..142 763 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 07:19:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15133-PA 142 GL15133-PA 1..142 1..142 763 100 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:19:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15896-PA 142 GA15896-PA 1..142 1..142 763 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 07:19:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18471-PA 142 GM18471-PA 1..142 1..142 763 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 07:19:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23285-PA 147 GD23285-PA 1..138 1..138 742 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 07:19:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19964-PA 142 GJ19964-PA 1..142 1..142 763 100 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 07:19:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24348-PA 142 GK24348-PA 1..142 1..142 763 100 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 07:19:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18287-PA 142 GE18287-PA 1..142 1..142 763 100 Plus