Clone RE13780 Report

Search the DGRC for RE13780

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:137
Well:80
Vector:pFlc-1
Associated Gene/TranscriptCG17272-RA
Protein status:RE13780.pep: gold
Preliminary Size:645
Sequenced Size:674

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17272 2001-12-17 Blastp of sequenced clone
CG17272 2002-01-01 Sim4 clustering to Release 2
CG17272 2003-01-01 Sim4 clustering to Release 3
CG17272 2008-04-29 Release 5.5 accounting
CG17272 2008-08-15 Release 5.9 accounting
CG17272 2008-12-18 5.12 accounting

Clone Sequence Records

RE13780.complete Sequence

674 bp (674 high quality bases) assembled on 2001-12-17

GenBank Submission: AY071049

> RE13780.complete
TTTGGTCACACTGGGCTGCTACCTGTTGAGTTCTACGCTTCGTTTATTTA
TTAACTCTATCTTATTGTTTACGGTATTTATTTATGGTTTAGTAAGCTTA
ATTCAACTAATTGAACGTATTTAAAAACTCTAAAATGGCTCGTTACTTTA
AAGAACAGGACATTGATGAGTTCCGTGAGTGTTTTTATCTGTTCGCCCGT
TCGGGCCAAATCAACAATTTGGACGAACTAACCGTTATTATGCGTTCTTT
GGGTCTTTCGCCGACGATCCAAGAACTGGTTTCCTATCTGAAGCAAAAGA
ATGGGAAAATGAGCTTCGCCGACTTCCTGGACATCATGCATCAGCACTCC
AAGGTGGAGAGTTTGCCGGACGAGGTCATTGCCGCCTTTAAAGCGGCCGA
TCCGCAGAATAAGGGCACCATCTCGGCTAGACAGCTGCGTAATCTACTTC
AAAACTGGGGAGAGGGCCTGTCCATGCGCGAAGTGGACAACATCTTCCGG
GAGGCCAATGTGAACAACAATAGCACTGTGCGGTATGCAGACTTTGTCAA
GATTGCATGCGCCCCAGTTCCCGACTACTATTAGACTGCCTTTACCATAA
AAAAACATTCCAGTAAAGTACTCCAATTTTCGCACAATAAAGTTGGCCAA
ATGTGTATGGAAAAAAAAAAAAAA

RE13780.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:36:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG17272-RA 685 CG17272-RA 19..683 2..665 3270 99.6 Plus
RpS20-RA 898 RpS20-RA 718..898 665..485 905 100 Minus
RpS20.a 549 RpS20.a 499..549 665..615 255 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:04:34
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 16647228..16647654 660..234 2120 99.8 Minus
chr3R 27901430 chr3R 16648007..16648144 138..2 640 99.3 Minus
chr3R 27901430 chr3R 16647716..16647783 235..168 340 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:35:37 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:04:32
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 20823308..20823739 665..234 2145 99.8 Minus
3R 32079331 3R 20824092..20824229 138..2 640 99.3 Minus
3R 32079331 3R 20823801..20823868 235..168 340 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:03:41
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 20564139..20564570 665..234 2145 99.7 Minus
3R 31820162 3R 20564923..20565060 138..2 650 99.2 Minus
3R 31820162 3R 20564632..20564699 235..168 340 100 Minus
3R 31820162 3R 20564766..20564797 168..137 160 100 Minus
Blast to na_te.dros performed 2019-03-16 03:04:32
Subject Length Description Subject Range Query Range Score Percent Strand
gtwin 7411 gtwin GTWIN 7411bp 1664..1731 534..466 117 65.2 Minus

RE13780.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:05:25 Download gff for RE13780.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 16648008..16648144 1..137 98   Minus
chr3R 16647228..16647654 234..660 99 <- Minus
chr3R 16647718..16647782 169..233 100 <- Minus
chr3R 16647850..16647880 138..168 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:55:43 Download gff for RE13780.complete
Subject Subject Range Query Range Percent Splice Strand
CG17272-RA 1..450 135..584 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:58:57 Download gff for RE13780.complete
Subject Subject Range Query Range Percent Splice Strand
CG17272-RA 1..450 135..584 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:16:02 Download gff for RE13780.complete
Subject Subject Range Query Range Percent Splice Strand
CG17272-RA 1..450 135..584 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:23:42 Download gff for RE13780.complete
Subject Subject Range Query Range Percent Splice Strand
CG17272-RA 1..450 135..584 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:30:24 Download gff for RE13780.complete
Subject Subject Range Query Range Percent Splice Strand
CG17272-RA 1..450 135..584 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:24:18 Download gff for RE13780.complete
Subject Subject Range Query Range Percent Splice Strand
CG17272-RA 1..660 2..660 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:58:57 Download gff for RE13780.complete
Subject Subject Range Query Range Percent Splice Strand
CG17272-RA 1..660 2..660 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:16:02 Download gff for RE13780.complete
Subject Subject Range Query Range Percent Splice Strand
CG17272-RA 9..670 1..660 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:23:42 Download gff for RE13780.complete
Subject Subject Range Query Range Percent Splice Strand
CG17272-RA 1..660 2..660 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:30:24 Download gff for RE13780.complete
Subject Subject Range Query Range Percent Splice Strand
CG17272-RA 9..670 1..660 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:05:25 Download gff for RE13780.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20823313..20823739 234..660 99 <- Minus
3R 20823803..20823867 169..233 100 <- Minus
3R 20823935..20823965 138..168 100 <- Minus
3R 20824093..20824229 1..137 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:05:25 Download gff for RE13780.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20823313..20823739 234..660 99 <- Minus
3R 20823803..20823867 169..233 100 <- Minus
3R 20823935..20823965 138..168 100 <- Minus
3R 20824093..20824229 1..137 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:05:25 Download gff for RE13780.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20823313..20823739 234..660 99 <- Minus
3R 20823803..20823867 169..233 100 <- Minus
3R 20823935..20823965 138..168 100 <- Minus
3R 20824093..20824229 1..137 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:16:02 Download gff for RE13780.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 16649035..16649461 234..660 99 <- Minus
arm_3R 16649525..16649589 169..233 100 <- Minus
arm_3R 16649657..16649687 138..168 100 <- Minus
arm_3R 16649815..16649951 1..137 98   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:58:48 Download gff for RE13780.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20564924..20565060 1..137 98   Minus
3R 20564144..20564570 234..660 99 <- Minus
3R 20564634..20564698 169..233 100 <- Minus
3R 20564766..20564796 138..168 100 <- Minus

RE13780.hyp Sequence

Translation from 134 to 583

> RE13780.hyp
MARYFKEQDIDEFRECFYLFARSGQINNLDELTVIMRSLGLSPTIQELVS
YLKQKNGKMSFADFLDIMHQHSKVESLPDEVIAAFKAADPQNKGTISARQ
LRNLLQNWGEGLSMREVDNIFREANVNNNSTVRYADFVKIACAPVPDYY*

RE13780.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:55:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG17272-PA 149 CG17272-PA 1..149 1..149 770 100 Plus
Cam-PD 149 CG8472-PD 1..143 1..138 219 37.1 Plus
Cam-PC 149 CG8472-PC 1..143 1..138 219 37.1 Plus
Cam-PE 149 CG8472-PE 1..143 1..138 219 37.1 Plus
Cam-PB 149 CG8472-PB 1..143 1..138 219 37.1 Plus

RE13780.pep Sequence

Translation from 134 to 583

> RE13780.pep
MARYFKEQDIDEFRECFYLFARSGQINNLDELTVIMRSLGLSPTIQELVS
YLKQKNGKMSFADFLDIMHQHSKVESLPDEVIAAFKAADPQNKGTISARQ
LRNLLQNWGEGLSMREVDNIFREANVNNNSTVRYADFVKIACAPVPDYY*

RE13780.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 03:08:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17013-PA 155 GF17013-PA 8..155 2..149 794 100 Plus
Dana\GF12835-PA 149 GF12835-PA 1..148 1..143 230 35.8 Plus
Dana\GF16772-PA 148 GF16772-PA 6..142 7..138 177 31.9 Plus
Dana\GF13648-PA 151 GF13648-PA 27..147 22..139 171 32 Plus
Dana\GF16770-PA 165 GF16770-PA 23..160 7..139 162 27.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 03:08:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15104-PA 149 GG15104-PA 1..149 1..149 801 100 Plus
Dere\GG20265-PA 149 GG20265-PA 1..148 1..143 230 35.8 Plus
Dere\GG11425-PA 148 GG11425-PA 6..142 7..138 179 32.6 Plus
Dere\GG11424-PA 164 GG11424-PA 48..163 32..143 169 32.8 Plus
Dere\GG14636-PA 151 GG14636-PA 27..145 22..137 167 32.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 03:08:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17271-PA 148 GH17271-PA 1..148 2..149 778 97.3 Plus
Dgri\GH23405-PA 151 GH23405-PA 9..145 7..138 191 35.5 Plus
Dgri\GH23399-PA 166 GH23399-PA 32..164 15..142 158 31.3 Plus
Dgri\GH10976-PA 190 GH10976-PA 50..183 12..140 151 28.9 Plus
Dgri\GH12737-PA 413 GH12737-PA 239..384 12..144 149 31.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:13:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG17272-PA 149 CG17272-PA 1..149 1..149 770 100 Plus
Cam-PD 149 CG8472-PD 1..143 1..138 219 37.1 Plus
Cam-PC 149 CG8472-PC 1..143 1..138 219 37.1 Plus
Cam-PE 149 CG8472-PE 1..143 1..138 219 37.1 Plus
Cam-PB 149 CG8472-PB 1..143 1..138 219 37.1 Plus
Cam-PA 149 CG8472-PA 1..143 1..138 219 37.1 Plus
Acam-PB 148 CG17769-PB 6..142 7..138 180 32.1 Plus
Acam-PA 148 CG17769-PA 6..142 7..138 180 32.1 Plus
CG11638-PA 387 CG11638-PA 204..352 3..138 167 30.2 Plus
CG17770-PA 164 CG17770-PA 22..160 7..140 165 30.9 Plus
CG13898-PA 151 CG13898-PA 12..145 9..137 153 29.6 Plus
sqh-PE 174 CG3595-PE 28..163 5..140 139 28.3 Plus
sqh-PD 174 CG3595-PD 28..163 5..140 139 28.3 Plus
sqh-PC 174 CG3595-PC 28..163 5..140 139 28.3 Plus
sqh-PB 174 CG3595-PB 28..163 5..140 139 28.3 Plus
sqh-PA 174 CG3595-PA 28..163 5..140 139 28.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 03:08:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10595-PA 148 GI10595-PA 1..148 2..149 769 96.6 Plus
Dmoj\GI20594-PA 149 GI20594-PA 1..148 1..143 230 35.8 Plus
Dmoj\GI10339-PA 149 GI10339-PA 7..143 7..138 193 35.5 Plus
Dmoj\GI10340-PA 150 GI10340-PA 8..144 7..138 178 35.5 Plus
Dmoj\GI17489-PA 205 GI17489-PA 65..198 12..140 159 28.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 03:08:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24278-PA 149 GL24278-PA 1..149 1..149 786 98 Plus
Dper\GL10814-PA 149 GL10814-PA 1..148 1..143 230 35.8 Plus
Dper\GL21535-PA 148 GL21535-PA 1..142 1..138 191 36.8 Plus
Dper\GL21536-PA 148 GL21536-PA 6..142 7..138 191 33.6 Plus
Dper\GL11704-PA 151 GL11704-PA 11..146 8..138 183 32.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 03:08:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14430-PB 149 GA14430-PB 1..149 1..149 786 98 Plus
Dpse\GA24499-PA 149 GA24499-PA 1..148 1..143 230 35.8 Plus
Dpse\GA26322-PA 148 GA26322-PA 6..142 7..138 191 33.6 Plus
Dpse\GA14657-PA 148 GA14657-PA 6..142 7..138 189 36.2 Plus
Dpse\GA24240-PA 151 GA24240-PA 11..146 8..138 186 32.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 03:08:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23155-PA 148 GM23155-PA 1..148 2..149 794 100 Plus
Dsec\GM21351-PA 149 GM21351-PA 1..148 1..143 230 35.8 Plus
Dsec\GM10265-PA 148 GM10265-PA 6..142 7..138 181 32.6 Plus
Dsec\GM10264-PA 164 GM10264-PA 20..163 5..143 172 31.2 Plus
Dsec\GM14251-PA 151 GM14251-PA 12..146 9..138 155 29.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 03:08:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20030-PA 149 GD20030-PA 1..149 1..149 801 100 Plus
Dsim\GD10849-PA 149 GD10849-PA 1..148 1..143 230 35.8 Plus
Dsim\GD21235-PA 148 GD21235-PA 6..142 7..138 181 32.6 Plus
Dsim\GD21234-PA 164 GD21234-PA 20..163 5..143 170 30.6 Plus
Dsim\GD13508-PA 151 GD13508-PA 12..146 9..138 154 30.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 03:08:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22950-PA 789 GJ22950-PA 648..789 8..149 734 95.1 Plus
Dvir\GJ10193-PA 151 GJ10193-PA 9..145 7..138 200 35.8 Plus
Dvir\GJ20779-PA 113 GJ20779-PA 1..112 36..143 181 35.7 Plus
Dvir\GJ10192-PA 166 GJ10192-PA 29..162 12..140 164 31.9 Plus
Dvir\GJ15110-PA 190 GJ15110-PA 50..183 12..140 153 28.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 03:08:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22694-PA 150 GK22694-PA 3..150 2..149 791 99.3 Plus
Dwil\GK22183-PA 149 GK22183-PA 1..148 1..143 230 35.8 Plus
Dwil\GK18988-PA 148 GK18988-PA 6..142 7..138 193 35.5 Plus
Dwil\GK21454-PA 151 GK21454-PA 10..147 8..140 172 30.9 Plus
Dwil\GK18987-PA 167 GK18987-PA 25..165 7..142 166 27 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 03:08:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25035-PA 161 GE25035-PA 14..161 2..149 792 100 Plus
Dyak\Cam-PA 149 GE12425-PA 1..148 1..143 230 35.8 Plus
Dyak\GE23620-PA 148 GE23620-PA 6..142 7..138 182 32.6 Plus
Dyak\GE20994-PA 151 GE20994-PA 27..145 22..137 174 33.3 Plus
Dyak\GE23619-PA 164 GE23619-PA 20..159 5..139 168 31.4 Plus