Clone RE13814 Report

Search the DGRC for RE13814

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:138
Well:14
Vector:pFlc-1
Associated Gene/TranscriptCG9849-RA
Protein status:RE13814.pep: gold
Sequenced Size:932

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9849 2001-12-14 Blastp of sequenced clone
CG9849 2002-01-01 Sim4 clustering to Release 2
CG9849 2003-01-01 Sim4 clustering to Release 3
CG9849 2008-04-29 Release 5.5 accounting
CG9849 2008-08-15 Release 5.9 accounting
CG9849 2008-12-18 5.12 accounting

Clone Sequence Records

RE13814.complete Sequence

932 bp (932 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071051

> RE13814.complete
GTCGGTTCATCCCTAACGCCATAAGAATTAGTTTGTTTTTTTTTTGCAAC
AAACATTTATATTAGTTATGCGTGCGTGGCCAAAATGCTAATCGCCTGGT
TAGTGCTTGCCGCCACTTTGAGCCGATCCATCAGAGCCAGCACCACGATA
TCGATACCGATCACAACGCAGGACATAATAGCGGGTGACGTGTTTTTTGA
AATCCTGTCCCCCTCGGAACTGGAATACACGTACCGGCTGCGCCCGGCCA
AGGACTTTGGATCCGCCTTCTCGGAGCGACTGGAGGGTGTGCCGCTAGTG
ATTACAGATCCCCCCGGCGCCTGCCAGGAGATCCGGAACGCCAGAGATCT
GAATGGGGGCGTCGCACTCATTGATCGAGGGGAGTGTTCCTTCCTCACGA
AGACACTTCGAGCGGAGGCAGCTGGCGCATTGGCTGCAATCATCACTGAG
TACAATCCCAGCTCTCCAGAGTTTGAGCACTACATCGAGATGATACATGA
CAACTCCCAACAGGACGCCAACATACCGGCCGGCTTTCTTCTCGGGAAGA
ATGGCGTCATCATCCGGTCGACGCTGCAGCGGCTGAAGAGGGTGCACGCC
CTGATCAACATACCGGTCAACCTCACCTTTACCCCGCCATCTAAGATTAA
TCATCCGCCGTGGCTGGGCTGGTGACGTGATCGGATTACATGCAGCTCAA
AGGACTCGTGTGAAAGAGACACACACGATCTGAAACCAAAGTGCATACTC
GTAGGCTGAGACGTCGAGACCGCAACTGAGACTATACTTTAGAGTACCAA
TAAGTAGCTAATTCGTAGACGGCAGCCATAAACTGTAAATAAATAGCTTA
GCAGCCAAAGAGTCAGGTCGCCAAGTTGTAATCTAGACAATACTATAATT
CTTAATTTTTATAGACAAAAAAAAAAAAAAAA

RE13814.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:40:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG9849-RA 995 CG9849-RA 72..989 1..919 4555 99.8 Plus
CG3831-RA 1762 CG3831-RA 1719..1762 919..876 220 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:37:20
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 18824999..18825535 380..916 2670 99.8 Plus
chr2R 21145070 chr2R 18824291..18824670 1..381 1855 99.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:35:39 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:37:18
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 22938489..22939028 380..919 2700 100 Plus
2R 25286936 2R 22937781..22938160 1..381 1855 99.7 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:07:41
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 22939688..22940227 380..919 2700 100 Plus
2R 25260384 2R 22938980..22939359 1..381 1865 99.7 Plus
Blast to na_te.dros performed on 2019-03-15 22:37:18 has no hits.

RE13814.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:37:57 Download gff for RE13814.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 18825000..18825535 381..916 99   Plus
chr2R 18824291..18824669 1..380 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:55:45 Download gff for RE13814.complete
Subject Subject Range Query Range Percent Splice Strand
CG9849-RA 1..591 85..675 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:05:24 Download gff for RE13814.complete
Subject Subject Range Query Range Percent Splice Strand
CG9849-RB 1..591 85..675 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:27:38 Download gff for RE13814.complete
Subject Subject Range Query Range Percent Splice Strand
CG9849-RA 1..591 85..675 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:30:01 Download gff for RE13814.complete
Subject Subject Range Query Range Percent Splice Strand
CG9849-RA 1..591 85..675 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:30:35 Download gff for RE13814.complete
Subject Subject Range Query Range Percent Splice Strand
CG9849-RA 1..591 85..675 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:33:15 Download gff for RE13814.complete
Subject Subject Range Query Range Percent Splice Strand
CG9849-RA 72..986 1..916 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:05:24 Download gff for RE13814.complete
Subject Subject Range Query Range Percent Splice Strand
CG9849-RB 46..960 1..916 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:27:38 Download gff for RE13814.complete
Subject Subject Range Query Range Percent Splice Strand
CG9849-RA 72..986 1..916 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:30:02 Download gff for RE13814.complete
Subject Subject Range Query Range Percent Splice Strand
CG9849-RA 72..986 1..916 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:30:35 Download gff for RE13814.complete
Subject Subject Range Query Range Percent Splice Strand
CG9849-RA 72..986 1..916 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:37:57 Download gff for RE13814.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22937781..22938159 1..380 99 -> Plus
2R 22938490..22939025 381..916 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:37:57 Download gff for RE13814.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22937781..22938159 1..380 99 -> Plus
2R 22938490..22939025 381..916 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:37:57 Download gff for RE13814.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22937781..22938159 1..380 99 -> Plus
2R 22938490..22939025 381..916 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:27:38 Download gff for RE13814.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 18825304..18825682 1..380 99 -> Plus
arm_2R 18826013..18826548 381..916 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:06:11 Download gff for RE13814.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22938998..22939376 1..380 99 -> Plus
2R 22939707..22940242 381..916 100   Plus

RE13814.hyp Sequence

Translation from 2 to 674

> RE13814.hyp
RFIPNAIRISLFFFATNIYISYACVAKMLIAWLVLAATLSRSIRASTTIS
IPITTQDIIAGDVFFEILSPSELEYTYRLRPAKDFGSAFSERLEGVPLVI
TDPPGACQEIRNARDLNGGVALIDRGECSFLTKTLRAEAAGALAAIITEY
NPSSPEFEHYIEMIHDNSQQDANIPAGFLLGKNGVIIRSTLQRLKRVHAL
INIPVNLTFTPPSKINHPPWLGW*

RE13814.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:32:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG9849-PB 196 CG9849-PB 1..196 28..223 1008 100 Plus
CG9849-PA 196 CG9849-PA 1..196 28..223 1008 100 Plus

RE13814.pep Sequence

Translation from 84 to 674

> RE13814.pep
MLIAWLVLAATLSRSIRASTTISIPITTQDIIAGDVFFEILSPSELEYTY
RLRPAKDFGSAFSERLEGVPLVITDPPGACQEIRNARDLNGGVALIDRGE
CSFLTKTLRAEAAGALAAIITEYNPSSPEFEHYIEMIHDNSQQDANIPAG
FLLGKNGVIIRSTLQRLKRVHALINIPVNLTFTPPSKINHPPWLGW*

RE13814.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:38:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13558-PA 196 GF13558-PA 1..196 1..196 937 87.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:38:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22818-PA 196 GG22818-PA 1..196 1..196 1020 98.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:38:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20969-PA 204 GH20969-PA 1..204 1..196 742 71.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:53:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG9849-PB 196 CG9849-PB 1..196 1..196 1008 100 Plus
CG9849-PA 196 CG9849-PA 1..196 1..196 1008 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:38:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21306-PA 194 GI21306-PA 5..194 6..196 717 73.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:38:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16268-PA 197 GL16268-PA 1..197 1..196 847 83.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:38:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22071-PA 197 GA22071-PA 1..197 1..196 896 83.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:38:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15975-PA 196 GM15975-PA 1..196 1..196 1022 99 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:38:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11727-PA 196 GD11727-PA 1..196 1..196 1017 98.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:38:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21572-PA 194 GJ21572-PA 1..194 1..196 826 77 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:38:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19546-PA 202 GK19546-PA 2..202 1..196 835 77.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:38:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14252-PA 196 GE14252-PA 1..196 1..196 1007 96.9 Plus