Clone RE13893 Report

Search the DGRC for RE13893

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:138
Well:93
Vector:pFlc-1
Associated Gene/TranscriptOsi20-RA
Protein status:RE13893.pep: gold
Preliminary Size:843
Sequenced Size:1275

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15188 2001-12-14 Blastp of sequenced clone
CG15188 2002-01-01 Sim4 clustering to Release 2
CG15188 2003-01-01 Sim4 clustering to Release 3
Osi20 2008-04-29 Release 5.5 accounting
Osi20 2008-08-15 Release 5.9 accounting
Osi20 2008-12-18 5.12 accounting

Clone Sequence Records

RE13893.complete Sequence

1275 bp (1275 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071052

> RE13893.complete
CATTGTCGCCGCATCGACTCCACAGTGAACACTACGCGCTCTGGTAGTGT
CAGTAATATCTAGTTGTATCTTTTTCGATTGGAAACACAATGGCTTTCCG
CTCCACGTCCTTGCTCGCGTTCGGTTGTGCGCTGCTGCTGGTGGCCTCCA
CATCCGTGTCCGGTGCTGCCATCGAGAACGCGGTGACCCCGCGGATCCAC
AGCTCCGACGAGCTGATCTCGACAATTGTGGATAAGTGCTTCCATGCCAA
TGCGATGCATTGCCTGAAGGAGAAGGTGCTCACCTACCTGGACACGGTAG
CCAATGTGGAGGAGGAGGTCAGCGGACGCGCCCTGGGTGACGATGTAATC
GACAAGGTCATTGTGGACCGCCTGGGCCGCATTCTGAACACCAACGAGAT
GAGGTTGCAGCTGCCACAGACCTTCTTCGCTGGTTCCGTGGTGACCTATC
GCTCGGATCGCGGTTTTGATCTGGAGTTGCCCAAGGATGAGGGTCGCGCT
GAGAAGAAGAACAAGGACAAGCTGTTCCTGCCCCTGCTGCTGCTGATGAA
GTTCAAGCTGAAGGTGATCATGCCCATCTTGCTGGCTCTGATCGGTCTGA
AGGCCACCAAGGCTCTGATTCTGTCCAAGATTGCCATCAAGCTGGTGCTG
GGCTTCCTGATCTACAACCTTATCCAGAAGTTGGGAGGCATGAAGATGAA
CATGGTGCCCATGCCCGCCCCAGTTCCGGCCAGCGAATACGGAGTGCCCA
GCACCACCGCCTCATCCTACGATCCCAGCAGCTGGGAGCCCATGAGCGGA
GGTCCCTATGCCCGTTGGGACTCGCAGAACCTGGCCTACAGCTCGTACCA
TCCTAGCAGCTCGTCGTCCTACTCCTCGGGATCCTCGTCGGGATCCTCGG
GTTCTTCGTCCAGCTACAGCTCGTCCTCCTAAACGGGGAAAGTCATTCGC
CCAATTGTACATACCAAGGAATTTGCGATCCTTCCCAGGAAGGATGGCTG
CGAGTCACACAGACCAAATGGAACCGGAACCTGCCCCAGGCCATAATTGT
AGTTGTTAGGGTTAGGAACGCGAGAGTTTTAGCCATTCTTCAGCTCTAAC
CACATCCCCACTTAGCCTGATTTTACCATCTTCTTCATACCATCTTCTTT
CTCATTGACTCTTCGTCCTTTTGCCTTCGTTTCTTTGTCACAAAACGACC
AAAAACTGAATTTAATTAATATTTATTTAATTTATTAAAAATGCAAAAAT
TTAAAACACTAAAAAAAAAAAAAAA

RE13893.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:40:22
Subject Length Description Subject Range Query Range Score Percent Strand
Osi20-RA 1628 Osi20-RA 100..1357 1..1258 6290 100 Plus
Osi20.c 1720 Osi20.c 461..1718 1..1258 6290 100 Plus
Osi20.a 1274 Osi20.a 506..1272 492..1258 3835 100 Plus
Osi20.a 1274 Osi20.a 3..494 1..492 2460 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:56:26
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 2166333..2167099 492..1258 3835 100 Plus
chr3R 27901430 chr3R 2165776..2166270 1..495 2475 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:35:43 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:56:24
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 6340656..6341422 492..1258 3835 100 Plus
3R 32079331 3R 6340099..6340593 1..495 2475 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:07:29
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 6081487..6082253 492..1258 3835 100 Plus
3R 31820162 3R 6080930..6081424 1..495 2475 100 Plus
Blast to na_te.dros performed 2019-03-16 11:56:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1507..1581 594..521 138 66.7 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2407..2478 592..521 126 63.9 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2300..2370 591..521 121 63.4 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2559..2655 618..521 118 59.2 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2310..2375 584..519 114 63.6 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6737..6800 584..521 113 64.1 Minus

RE13893.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:57:27 Download gff for RE13893.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 2165776..2166267 1..492 100 -> Plus
chr3R 2166334..2167100 493..1260 95   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:55:48 Download gff for RE13893.complete
Subject Subject Range Query Range Percent Splice Strand
Osi20-RA 1..843 90..932 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:05:03 Download gff for RE13893.complete
Subject Subject Range Query Range Percent Splice Strand
Osi20-RA 1..843 90..932 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:33:34 Download gff for RE13893.complete
Subject Subject Range Query Range Percent Splice Strand
Osi20-RA 1..843 90..932 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:29:43 Download gff for RE13893.complete
Subject Subject Range Query Range Percent Splice Strand
Osi20-RA 1..843 90..932 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:30:45 Download gff for RE13893.complete
Subject Subject Range Query Range Percent Splice Strand
Osi20-RA 1..843 90..932 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:32:48 Download gff for RE13893.complete
Subject Subject Range Query Range Percent Splice Strand
Osi20-RA 3..1261 1..1260 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:05:03 Download gff for RE13893.complete
Subject Subject Range Query Range Percent Splice Strand
Osi20-RA 3..1261 1..1260 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:33:34 Download gff for RE13893.complete
Subject Subject Range Query Range Percent Splice Strand
Osi20-RA 5..1263 1..1260 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:29:43 Download gff for RE13893.complete
Subject Subject Range Query Range Percent Splice Strand
Osi20-RA 3..1261 1..1260 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:30:45 Download gff for RE13893.complete
Subject Subject Range Query Range Percent Splice Strand
Osi20-RA 5..1263 1..1260 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:57:27 Download gff for RE13893.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6340099..6340590 1..492 100 -> Plus
3R 6340657..6341423 493..1260 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:57:27 Download gff for RE13893.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6340099..6340590 1..492 100 -> Plus
3R 6340657..6341423 493..1260 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:57:27 Download gff for RE13893.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6340099..6340590 1..492 100 -> Plus
3R 6340657..6341423 493..1260 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:33:34 Download gff for RE13893.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 2165821..2166312 1..492 100 -> Plus
arm_3R 2166379..2167145 493..1260 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:05:48 Download gff for RE13893.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6080930..6081421 1..492 100 -> Plus
3R 6081488..6082254 493..1260 99   Plus

RE13893.pep Sequence

Translation from 89 to 931

> RE13893.pep
MAFRSTSLLAFGCALLLVASTSVSGAAIENAVTPRIHSSDELISTIVDKC
FHANAMHCLKEKVLTYLDTVANVEEEVSGRALGDDVIDKVIVDRLGRILN
TNEMRLQLPQTFFAGSVVTYRSDRGFDLELPKDEGRAEKKNKDKLFLPLL
LLMKFKLKVIMPILLALIGLKATKALILSKIAIKLVLGFLIYNLIQKLGG
MKMNMVPMPAPVPASEYGVPSTTASSYDPSSWEPMSGGPYARWDSQNLAY
SSYHPSSSSSYSSGSSSGSSGSSSSYSSSS*

RE13893.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:36:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16393-PA 280 GF16393-PA 1..250 1..249 1104 94.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:36:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13313-PA 280 GG13313-PA 1..280 1..280 1450 98.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:36:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14037-PA 280 GH14037-PA 1..249 1..249 1015 88 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:22:28
Subject Length Description Subject Range Query Range Score Percent Strand
Osi20-PA 280 CG15188-PA 1..280 1..280 1401 100 Plus
Osi9-PA 233 CG15592-PA 1..181 8..185 175 23.9 Plus
Osi7-PA 288 CG1153-PA 6..264 9..279 172 21.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:36:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24411-PA 277 GI24411-PA 1..247 1..249 981 89.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:36:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24074-PA 276 GL24074-PA 1..245 1..249 1075 89.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:36:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13556-PA 276 GA13556-PA 1..245 1..249 1075 89.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:36:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10884-PA 280 GM10884-PA 1..280 1..280 1462 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:36:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19863-PA 280 GD19863-PA 1..280 1..280 1462 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:36:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14269-PA 277 GJ14269-PA 1..247 1..249 1057 87.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:36:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13053-PA 279 GK13053-PA 1..247 1..249 1097 89.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:36:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10208-PA 281 GE10208-PA 1..281 1..280 1448 99.3 Plus

RE13893.hyp Sequence

Translation from 89 to 931

> RE13893.hyp
MAFRSTSLLAFGCALLLVASTSVSGAAIENAVTPRIHSSDELISTIVDKC
FHANAMHCLKEKVLTYLDTVANVEEEVSGRALGDDVIDKVIVDRLGRILN
TNEMRLQLPQTFFAGSVVTYRSDRGFDLELPKDEGRAEKKNKDKLFLPLL
LLMKFKLKVIMPILLALIGLKATKALILSKIAIKLVLGFLIYNLIQKLGG
MKMNMVPMPAPVPASEYGVPSTTASSYDPSSWEPMSGGPYARWDSQNLAY
SSYHPSSSSSYSSGSSSGSSGSSSSYSSSS*

RE13893.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:52:48
Subject Length Description Subject Range Query Range Score Percent Strand
Osi20-PA 280 CG15188-PA 1..280 1..280 1401 100 Plus
Osi9-PA 233 CG15592-PA 1..181 8..185 175 23.9 Plus
Osi7-PA 288 CG1153-PA 6..264 9..279 172 21.1 Plus