BDGP Sequence Production Resources |
Search the DGRC for RE14101
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 141 |
Well: | 1 |
Vector: | pFlc-1 |
Associated Gene/Transcript | Zasp66-RH |
Protein status: | RE14101.pep: gold |
Sequenced Size: | 1134 |
Gene | Date | Evidence |
---|---|---|
CG6416-RH | 2009-06-22 | Manual selection by Sue Celniker |
1134 bp assembled on 2009-07-30
GenBank Submission: BT089012.1
> RE14101.complete AGGTGCGTTCGGAATATTGAAAAATAAACAACAATAAGACTCGAGCTCGA GCATCCTTTTTGTAGTGAATCCTAGTGTAAAGATCTCCGATCTCACCAGC TGCAGCGTTGATTTAAACGTGACGAAGAAGAGTTTAAATTCAAACACAAA ACACACACATTGCAAAAATGGAGTACGTTCAGTTCAAAAACGGATCCCCA GTCTACTACAAGGAGCAGCCAGACCTCAATGAGTGCATTCAATACCAACC CTACCGTACAACTCCGCTGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATG CGCCCACGACAGAGTCCTACTTGAGGCACTACCCCAACCCGGCTGTGCGC GCCCACCCAGGACACGACTACCATGACAGTATCATGAAGCAGCGCGTGGC CGACACCATGCTGCACAAGGTGGTCGGTTCGGAAGCCGACACTGGCCGCG TCTTCCACAAGCAATTCAACTCGCCCATTGGCCTGTACTCCAACAACAAC ATCGAGGACACCATCAGATCCACAGTTCCAAACCAGTATCAGCGCCAGTA TCCCGGCCGCCGTACAATGTGGTAAACACCCACGATGAGAACATACGCCA GAGCGGCTCCTTCAATCGTCTCATGTACAGCGTGATTGGTGCCACCGAGT ACTAGAAAGTGCAGCTGCAACACCAGCGACAGCAGCAACATCAACATCAA CGCAACATCGGCAACATCTGCTGCACTTGTTTTATCTCCTAACATATTTA GCGGATTTTTATGAAATTCTGTTTAACTTACTCAATAAATTATATGAAGA ACGACAAGAAATTGTGAACCACTAACAAGCTTGATGATATAATGGATTGG TAATCAATTGGCATCGAAATAAATTTACGATATAAACACCACTTAACGCC GCCTCAACCTAATTACTGTCTGCACATGCAATAGAAAACGTATATAAATT AATTAAATAAAAAAAAAAGGAAAGTAAAATTTGGTTTATAGTTATGTTTA TGTTATGCTGATTCTAAGTTAACAGCCAGTCAGGCGTGTTAATACCGAGT GATTCTAGTCATGGAATGTAATAGGTATTAAGAATGTTTTAATTAATAAA AGTGACTTTGATTGGAAGAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Zasp66-RH | 1260 | Zasp66-RH | 105..1226 | 4..1125 | 5565 | 99.7 | Plus |
Zasp66-RI | 1390 | Zasp66-RI | 791..1386 | 530..1125 | 2935 | 99.4 | Plus |
Zasp66-RA | 1401 | Zasp66-RA | 804..1399 | 530..1125 | 2935 | 99.4 | Plus |
Zasp66-RI | 1390 | Zasp66-RI | 105..630 | 4..529 | 2630 | 100 | Plus |
Zasp66-RA | 1401 | Zasp66-RA | 46..571 | 4..529 | 2630 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 8630302..8630848 | 569..1116 | 2645 | 99.3 | Plus |
chr3L | 24539361 | chr3L | 8626610..8626816 | 245..451 | 1005 | 99 | Plus |
chr3L | 24539361 | chr3L | 8622282..8622408 | 4..130 | 635 | 100 | Plus |
chr3L | 24539361 | chr3L | 8622548..8622666 | 130..248 | 595 | 100 | Plus |
chr3L | 24539361 | chr3L | 8627036..8627112 | 453..529 | 370 | 98.7 | Plus |
chr3L | 24539361 | chr3L | 8630192..8630233 | 530..571 | 210 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 8638267..8638823 | 569..1125 | 2740 | 99.5 | Plus |
3L | 28110227 | 3L | 8634579..8634785 | 245..451 | 1020 | 99.5 | Plus |
3L | 28110227 | 3L | 8630251..8630377 | 4..130 | 635 | 100 | Plus |
3L | 28110227 | 3L | 8630517..8630635 | 130..248 | 595 | 100 | Plus |
3L | 28110227 | 3L | 8635002..8635081 | 450..529 | 400 | 100 | Plus |
3L | 28110227 | 3L | 8638157..8638198 | 530..571 | 210 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 8631367..8631923 | 569..1125 | 2740 | 99.4 | Plus |
3L | 28103327 | 3L | 8627679..8627885 | 245..451 | 1020 | 99.5 | Plus |
3L | 28103327 | 3L | 8623351..8623477 | 4..130 | 635 | 100 | Plus |
3L | 28103327 | 3L | 8623617..8623735 | 130..248 | 595 | 100 | Plus |
3L | 28103327 | 3L | 8628102..8628181 | 450..529 | 400 | 100 | Plus |
3L | 28103327 | 3L | 8631257..8631298 | 530..571 | 210 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6828..6890 | 657..718 | 186 | 79.4 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2295..2371 | 649..725 | 177 | 73.1 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6721..6804 | 646..725 | 167 | 70.2 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 1512..1587 | 656..724 | 166 | 73.7 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6722..6783 | 662..725 | 162 | 76.9 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6798..6879 | 648..725 | 157 | 69.5 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2761..2840 | 648..726 | 155 | 71.1 | Plus |
roo | 9092 | roo DM_ROO 9092bp | 1083..1154 | 648..718 | 150 | 69.4 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6753..6825 | 657..725 | 148 | 71.2 | Plus |
roo | 9092 | roo DM_ROO 9092bp | 1092..1273 | 648..818 | 148 | 59.1 | Plus |
Dvir\Het-A | 6610 | Dvir\Het-A HETAVIR 6610bp | 3280..3345 | 657..721 | 147 | 71.2 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2340..2404 | 662..725 | 142 | 70.8 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6774..6839 | 657..718 | 140 | 72.7 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2789..2854 | 661..725 | 138 | 69.7 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6794..6855 | 662..725 | 135 | 70.3 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2383..2461 | 648..725 | 133 | 67.1 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2632..2665 | 663..696 | 125 | 85.3 | Plus |
Doc3-element | 4740 | Doc3-element DOC3 4740bp | 528..577 | 653..705 | 123 | 73.6 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2418..2484 | 643..715 | 117 | 67.1 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 1541..1581 | 661..701 | 115 | 75.6 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2602..2665 | 648..707 | 112 | 68.8 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 8622279..8622411 | 1..132 | 97 | -> | Plus |
chr3L | 8622551..8622666 | 133..248 | 100 | -> | Plus |
chr3L | 8626614..8626814 | 249..449 | 99 | -> | Plus |
chr3L | 8627033..8627112 | 450..529 | 97 | -> | Plus |
chr3L | 8630192..8630230 | 530..568 | 100 | -> | Plus |
chr3L | 8630302..8630393 | 569..660 | 100 | == | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6416-RA | 1..357 | 168..524 | 100 | -> | Plus |
CG6416-RA | 590..720 | 525..655 | 96 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Zasp66-RA | 1..357 | 168..524 | 100 | -> | Plus |
Zasp66-RA | 590..720 | 525..655 | 96 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Zasp66-RH | 1..408 | 168..575 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Zasp66-RH | 1..408 | 168..575 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6416-RH | 3..957 | 1..958 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Zasp66-RH | 41..998 | 1..958 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Zasp66-RH | 6..963 | 1..958 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Zasp66-RH | 6..1120 | 1..1115 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 8630248..8630380 | 1..132 | 97 | -> | Plus |
3L | 8630520..8630635 | 133..248 | 100 | -> | Plus |
3L | 8634583..8634783 | 249..449 | 100 | -> | Plus |
3L | 8635002..8635081 | 450..529 | 100 | -> | Plus |
3L | 8638157..8638195 | 530..568 | 100 | -> | Plus |
3L | 8638267..8638816 | 569..1118 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 8630248..8630380 | 1..132 | 97 | -> | Plus |
3L | 8630520..8630635 | 133..248 | 100 | -> | Plus |
3L | 8634583..8634783 | 249..449 | 100 | -> | Plus |
3L | 8635002..8635081 | 450..529 | 100 | -> | Plus |
3L | 8638157..8638195 | 530..568 | 100 | -> | Plus |
3L | 8638267..8638816 | 569..1118 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 8630248..8630380 | 1..132 | 97 | -> | Plus |
3L | 8630520..8630635 | 133..248 | 100 | -> | Plus |
3L | 8634583..8634783 | 249..449 | 100 | -> | Plus |
3L | 8635002..8635081 | 450..529 | 100 | -> | Plus |
3L | 8638157..8638195 | 530..568 | 100 | -> | Plus |
3L | 8638267..8638816 | 569..1118 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 8623348..8623480 | 1..132 | 97 | -> | Plus |
arm_3L | 8623620..8623735 | 133..248 | 100 | -> | Plus |
arm_3L | 8627683..8627883 | 249..449 | 100 | -> | Plus |
arm_3L | 8628102..8628181 | 450..529 | 100 | -> | Plus |
arm_3L | 8631257..8631295 | 530..568 | 100 | -> | Plus |
arm_3L | 8631367..8631916 | 569..1118 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 8631367..8631916 | 569..1118 | 99 | Plus | |
3L | 8623348..8623480 | 1..132 | 97 | -> | Plus |
3L | 8623620..8623735 | 133..248 | 100 | -> | Plus |
3L | 8627683..8627883 | 249..449 | 100 | -> | Plus |
3L | 8628102..8628181 | 450..529 | 100 | -> | Plus |
3L | 8631257..8631295 | 530..568 | 100 | -> | Plus |
Translation from 167 to 574
> RE14101.pep MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF NSPIGLYSNNNIEDTIRSTVPNQYQRQYPGRRTMW*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24342-PA | 430 | GF24342-PA | 191..311 | 1..121 | 646 | 98.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG14334-PA | 429 | GG14334-PA | 191..311 | 1..121 | 653 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH22528-PA | 181 | GH22528-PA | 1..121 | 1..121 | 630 | 95 | Plus |
Dgri\GH15318-PA | 149 | GH15318-PA | 5..31 | 95..121 | 134 | 92.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Zasp66-PH | 135 | CG6416-PH | 1..135 | 1..135 | 740 | 100 | Plus |
Zasp66-PI | 215 | CG6416-PI | 1..133 | 1..133 | 664 | 93.2 | Plus |
Zasp66-PG | 165 | CG6416-PG | 1..121 | 1..121 | 656 | 100 | Plus |
Zasp66-PA | 239 | CG6416-PA | 1..121 | 1..121 | 656 | 100 | Plus |
Zasp66-PJ | 239 | CG6416-PJ | 1..121 | 1..121 | 656 | 100 | Plus |
Zasp66-PB | 298 | CG6416-PB | 177..298 | 17..135 | 597 | 92.6 | Plus |
Zasp66-PO | 326 | CG6416-PO | 205..326 | 17..135 | 597 | 92.6 | Plus |
Zasp66-PM | 322 | CG6416-PM | 177..322 | 17..135 | 562 | 77.4 | Plus |
Zasp66-PK | 378 | CG6416-PK | 177..296 | 17..133 | 521 | 85 | Plus |
Zasp66-PN | 406 | CG6416-PN | 205..324 | 17..133 | 521 | 85 | Plus |
Zasp66-PF | 402 | CG6416-PF | 177..284 | 17..121 | 513 | 91.7 | Plus |
Zasp66-PE | 430 | CG6416-PE | 205..312 | 17..121 | 513 | 91.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI12917-PA | 429 | GI12917-PA | 191..311 | 1..121 | 635 | 95.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL10326-PA | 417 | GL10326-PA | 229..349 | 1..121 | 641 | 96.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA19576-PA | 240 | GA19576-PA | 1..121 | 1..121 | 636 | 96.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25076-PA | 429 | GM25076-PA | 191..311 | 1..121 | 654 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ13061-PA | 429 | GJ13061-PA | 191..311 | 1..121 | 635 | 95.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK16724-PA | 243 | GK16724-PA | 1..121 | 1..121 | 634 | 96.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE20762-PA | 429 | GE20762-PA | 191..311 | 1..121 | 653 | 100 | Plus |
Translation from 167 to 574
> RE14101.hyp MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF NSPIGLYSNNNIEDTIRSTVPNQYQRQYPGRRTMW*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Zasp66-PH | 135 | CG6416-PH | 1..135 | 1..135 | 740 | 100 | Plus |
Zasp66-PI | 215 | CG6416-PI | 1..133 | 1..133 | 664 | 93.2 | Plus |
Zasp66-PG | 165 | CG6416-PG | 1..121 | 1..121 | 656 | 100 | Plus |
Zasp66-PA | 239 | CG6416-PA | 1..121 | 1..121 | 656 | 100 | Plus |
Zasp66-PJ | 239 | CG6416-PJ | 1..121 | 1..121 | 656 | 100 | Plus |