Clone RE14116 Report

Search the DGRC for RE14116

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:141
Well:16
Vector:pFlc-1
Associated Gene/Transcriptmago-RA
Protein status:RE14116.pep: gold
Preliminary Size:680
Sequenced Size:1116

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9401 2001-12-14 Blastp of sequenced clone
CG9401 2002-01-01 Sim4 clustering to Release 2
CG9401 2003-01-01 Sim4 clustering to Release 3
mago 2008-04-29 Release 5.5 accounting
mago 2008-08-15 Release 5.9 accounting
mago 2008-12-18 5.12 accounting

Clone Sequence Records

RE14116.complete Sequence

1116 bp (1116 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071060

> RE14116.complete
ATTCCGTGTGTTTTCCCATCTCTAACGCGTTGTAGTAAAGGAAAAAGAGT
GGGAAACCAAAAATTGATATTTTTCTGAAAGTCTTTCAAAGTTACGCTTT
AAACTAGAAGCAATCATGTCCACGGAGGACTTTTACCTACGCTACTACGT
CGGACACAAGGGCAAGTTCGGGCACGAATTCTTGGAGTTCGAGTTCCGGC
CGGATGGCAAGCTGCGGTACGCCAACAACTCCAACTACAAGAACGACACC
ATGATCCGCAAGGAGGCCTTCGTCCACCAGTCCGTGATGGAAGAACTGAA
GCGAATCATCATCGACTCGGAGATCATGCAGGAGGACGATCTGCCCTGGC
CGCCACCAGATCGCGTGGGTCGACAGGAACTGGAGATCGTCATCGGAGAC
GAGCACATCTCGTTCACCACCTCGAAAACGGGATCATTGGTGGACGTGAA
CCGGTCAAAAGATCCCGAGGGCCTGCGATGCTTTTACTACCTGGTGCAGG
ATCTCAAGTGCCTGGTCTTCTCACTCATCGGCCTGCATTTCAAGATCAAG
CCCATATAAGCCGTAGCCACCACCTCAAGCATAGCCTATTTATCGGACGG
ACACATCGTATTTTATAATGGAACTTCTACGATACTTGTAATTGTATAAG
CTATACCTTTGTACTTTTTGGTACAGTTTGCAGTGAATAAAAAAGGATTG
GAAGATACTTTGTTTTCAAAGTCTTGTGTACAGTCTAGATTGTGCTATAG
AAGTAAATAGCAAATCTTCGATGTAGTAGCAGACAACAAGTTTAACAATA
ATAGCAAACACAATAGTAAACCATTTAACTTTTGATGTTATAATGTGTAG
GTATATTTGAAAAATACAATTTAATATCTATTGTGTTTGAATAATATACA
TACTCGAGATAAAAATTTAAAGTCCTTTACATTTGTACAATTCGTATATG
TCTAAAACAGCTTAAGCTAAGTGATTAATATCTCACAAACTGGCAAATTG
TCTTAACGTTTAAGTACAAGCAGTAACTTAGCCTAAGATAATGATCGGTA
TCTTAAGAAACTGGAATAAAATACGCACTCACATACGGTTTTGAGACTTG
CAAAAAAAAAAAAAAA

RE14116.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:43:40
Subject Length Description Subject Range Query Range Score Percent Strand
mago-RA 1207 mago-RA 77..1180 1..1104 5520 100 Plus
Magi-RA 5307 Magi-RA 5027..5307 1104..824 1405 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:19:19
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 17015434..17016160 374..1101 3545 99.5 Plus
chr2R 21145070 chr2R 17015003..17015379 1..377 1885 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:36:02 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:19:17
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21129010..21129740 374..1104 3655 100 Plus
2R 25286936 2R 21128579..21128955 1..377 1885 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:10:29
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 21130209..21130939 374..1104 3655 100 Plus
2R 25260384 2R 21129778..21130154 1..377 1885 100 Plus
Blast to na_te.dros performed 2019-03-16 12:19:18
Subject Length Description Subject Range Query Range Score Percent Strand
mdg1 7480 mdg1 DMRTMGD1 7480bp Derived from X59545 (g8507) (Rel. 49, Last updated, Version 4). 5514..5582 759..828 131 67.1 Plus
Stalker4 7359 Stalker4 STALKER4 7359bp 6551..6666 737..617 114 60.7 Minus
Stalker 7256 Stalker STALKER 7256bp 6445..6560 737..617 114 60.7 Minus

RE14116.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:20:35 Download gff for RE14116.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 17015003..17015378 1..376 100 -> Plus
chr2R 17015437..17016160 377..1101 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:56:03 Download gff for RE14116.complete
Subject Subject Range Query Range Percent Splice Strand
mago-RA 1..444 116..559 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:09:59 Download gff for RE14116.complete
Subject Subject Range Query Range Percent Splice Strand
mago-RA 1..444 116..559 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 14:47:15 Download gff for RE14116.complete
Subject Subject Range Query Range Percent Splice Strand
mago-RA 1..444 116..559 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:34:10 Download gff for RE14116.complete
Subject Subject Range Query Range Percent Splice Strand
mago-RA 1..444 116..559 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:43:01 Download gff for RE14116.complete
Subject Subject Range Query Range Percent Splice Strand
mago-RA 1..444 116..559 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:39:41 Download gff for RE14116.complete
Subject Subject Range Query Range Percent Splice Strand
mago-RA 1..1101 1..1101 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:09:59 Download gff for RE14116.complete
Subject Subject Range Query Range Percent Splice Strand
mago-RA 1..1101 1..1101 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 14:47:15 Download gff for RE14116.complete
Subject Subject Range Query Range Percent Splice Strand
mago-RA 3..1103 1..1101 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:34:10 Download gff for RE14116.complete
Subject Subject Range Query Range Percent Splice Strand
mago-RA 1..1101 1..1101 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:43:01 Download gff for RE14116.complete
Subject Subject Range Query Range Percent Splice Strand
mago-RA 3..1103 1..1101 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:20:35 Download gff for RE14116.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21128579..21128954 1..376 100 -> Plus
2R 21129013..21129737 377..1101 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:20:35 Download gff for RE14116.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21128579..21128954 1..376 100 -> Plus
2R 21129013..21129737 377..1101 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:20:35 Download gff for RE14116.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21128579..21128954 1..376 100 -> Plus
2R 21129013..21129737 377..1101 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 14:47:15 Download gff for RE14116.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17016084..17016459 1..376 100 -> Plus
arm_2R 17016518..17017242 377..1101 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:11:20 Download gff for RE14116.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21129778..21130153 1..376 100 -> Plus
2R 21130212..21130936 377..1101 100   Plus

RE14116.pep Sequence

Translation from 115 to 558

> RE14116.pep
MSTEDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDTMIRKE
AFVHQSVMEELKRIIIDSEIMQEDDLPWPPPDRVGRQELEIVIGDEHISF
TTSKTGSLVDVNRSKDPEGLRCFYYLVQDLKCLVFSLIGLHFKIKPI*

RE14116.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:09:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11935-PA 147 GF11935-PA 1..147 1..147 783 100 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:09:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22089-PA 147 GG22089-PA 1..147 1..147 783 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:09:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20720-PA 147 GH20720-PA 1..147 1..147 783 100 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:07:26
Subject Length Description Subject Range Query Range Score Percent Strand
mago-PA 147 CG9401-PA 1..147 1..147 783 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:09:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20805-PA 147 GI20805-PA 1..147 1..147 783 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:09:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10152-PA 147 GL10152-PA 1..147 1..147 779 99.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:09:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21763-PA 147 GA21763-PA 1..147 1..147 779 99.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:09:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15806-PA 147 GM15806-PA 1..147 1..147 783 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:09:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11565-PA 147 GD11565-PA 1..147 1..147 783 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:09:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20538-PA 147 GJ20538-PA 1..147 1..147 783 100 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:09:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20976-PA 147 GK20976-PA 1..147 1..147 776 99.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:09:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\mago-PA 147 GE12169-PA 1..147 1..147 783 100 Plus

RE14116.hyp Sequence

Translation from 115 to 558

> RE14116.hyp
MSTEDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDTMIRKE
AFVHQSVMEELKRIIIDSEIMQEDDLPWPPPDRVGRQELEIVIGDEHISF
TTSKTGSLVDVNRSKDPEGLRCFYYLVQDLKCLVFSLIGLHFKIKPI*

RE14116.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:40:47
Subject Length Description Subject Range Query Range Score Percent Strand
mago-PA 147 CG9401-PA 1..147 1..147 783 100 Plus