Clone RE14402 Report

Search the DGRC for RE14402

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:144
Well:2
Vector:pFlc-1
Associated Gene/TranscriptCG3224-RA
Protein status:RE14402.pep: gold
Preliminary Size:489
Sequenced Size:853

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3224 2001-12-14 Blastp of sequenced clone
CG3224 2002-01-01 Sim4 clustering to Release 2
CG3224 2003-01-01 Sim4 clustering to Release 3
CG3224 2008-04-29 Release 5.5 accounting
CG3224 2008-08-15 Release 5.9 accounting
CG3224 2008-12-18 5.12 accounting

Clone Sequence Records

RE14402.complete Sequence

853 bp (853 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071068

> RE14402.complete
AGGAAACCAATCGGCCGGGGACCGTCGCCAACATTCTATGTGCGCATTAA
ATTAACTTGTTACCTTTAAAACCCTCGTTTCTTAACCAAAAAAAGGTTTT
AGGAAACACCTAGCAGCAGCAGCAGAATCTAAAACCCCATTGGCAACCAA
AACACGTGCCAAAACAAACGATTAAATTTTCCGTAAAAGTTGTAAATATA
AAAAAAAGTCAGCAAGATGGGAATGGTATCGAAACGCAAGAAGATGCACT
ATGGCGATACCCATCTGCAGAGGAGATGGCGTGTGCGGAATCGACGTCGT
GATCTCGACCAGATCGACGACGATCTGCAGACCCGGAGCGGTGAACTGAT
CAATCAGAATGTGGATCTCGACAAGCCGGGATTCGCGCAGTTCTACTGCG
TGCACTGTGCCAAGTACTTCATCGATGACACCGCCATGCAGGCACATTTC
CGCACCAAGGTGCACAAGAGGCGTCTCAAGGCCCTAGAGATCGAGCCGTA
CAGCATCGAGGAGGCGGAACGCGCCGCGGGACGTGGCAGCTTCGTGAAGC
CCAAGAAGCGGGCGATGGAAACGCAGCCATCGAAGGAGGACGTGGTCGCT
GGCAAGAGGATCCGAGTGGAAGTGGTGCCCGAGGATACAGATGCCACCGA
TTCGCCATCGACGTCCAAAACGAAGCGCAAGAAAGTCGAGAAAATGGAGA
CATAGGCGAGGAGGATGAACCAATCTATTGATCTAGCTTAGTTTTTAAGG
CCCTCGGGGACAGGACTTTCTTCACCCCCCTCCCACAGAACTCTGTTTAC
CTCCAATTGCTTTCTTTAAATACATTTTTTTTCCAACAAAAAAAAAAAAA
AAA

RE14402.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:40:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG3224-RA 898 CG3224-RA 50..885 3..838 4180 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:51:15
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 6552792..6553534 837..94 3490 98.3 Minus
chrX 22417052 chrX 6553591..6553685 97..3 460 98.9 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:36:18 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:51:13
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 6660551..6661295 838..94 3725 100 Minus
X 23542271 X 6661352..6661446 97..3 475 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:07:56
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 6668649..6669393 838..94 3725 100 Minus
X 23527363 X 6669450..6669544 97..3 475 100 Minus
Blast to na_te.dros performed 2019-03-16 18:51:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2341..2401 105..166 118 67.7 Plus

RE14402.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:51:55 Download gff for RE14402.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 6552792..6553532 96..837 98 <- Minus
chrX 6553593..6553686 1..95 97   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:56:19 Download gff for RE14402.complete
Subject Subject Range Query Range Percent Splice Strand
CG3224-RA 1..489 217..705 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:05:47 Download gff for RE14402.complete
Subject Subject Range Query Range Percent Splice Strand
CG3224-RA 1..489 217..705 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:17:52 Download gff for RE14402.complete
Subject Subject Range Query Range Percent Splice Strand
CG3224-RA 1..489 217..705 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:30:22 Download gff for RE14402.complete
Subject Subject Range Query Range Percent Splice Strand
CG3224-RA 1..489 217..705 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:52:36 Download gff for RE14402.complete
Subject Subject Range Query Range Percent Splice Strand
CG3224-RA 1..489 217..705 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:33:56 Download gff for RE14402.complete
Subject Subject Range Query Range Percent Splice Strand
CG3224-RA 2..835 3..836 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:05:47 Download gff for RE14402.complete
Subject Subject Range Query Range Percent Splice Strand
CG3224-RA 2..835 3..836 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:17:52 Download gff for RE14402.complete
Subject Subject Range Query Range Percent Splice Strand
CG3224-RA 15..851 1..837 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:30:23 Download gff for RE14402.complete
Subject Subject Range Query Range Percent Splice Strand
CG3224-RA 2..835 3..836 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:52:36 Download gff for RE14402.complete
Subject Subject Range Query Range Percent Splice Strand
CG3224-RA 15..851 1..837 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:51:55 Download gff for RE14402.complete
Subject Subject Range Query Range Percent Splice Strand
X 6660552..6661293 96..837 100 <- Minus
X 6661354..6661447 1..95 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:51:55 Download gff for RE14402.complete
Subject Subject Range Query Range Percent Splice Strand
X 6660552..6661293 96..837 100 <- Minus
X 6661354..6661447 1..95 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:51:55 Download gff for RE14402.complete
Subject Subject Range Query Range Percent Splice Strand
X 6660552..6661293 96..837 100 <- Minus
X 6661354..6661447 1..95 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:17:52 Download gff for RE14402.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 6555387..6555480 1..95 98   Minus
arm_X 6554585..6555326 96..837 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:06:38 Download gff for RE14402.complete
Subject Subject Range Query Range Percent Splice Strand
X 6668650..6669391 96..837 100 <- Minus
X 6669452..6669545 1..95 98   Minus

RE14402.pep Sequence

Translation from 216 to 704

> RE14402.pep
MGMVSKRKKMHYGDTHLQRRWRVRNRRRDLDQIDDDLQTRSGELINQNVD
LDKPGFAQFYCVHCAKYFIDDTAMQAHFRTKVHKRRLKALEIEPYSIEEA
ERAAGRGSFVKPKKRAMETQPSKEDVVAGKRIRVEVVPEDTDATDSPSTS
KTKRKKVEKMET*

RE14402.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:43:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21899-PA 161 GF21899-PA 1..161 1..162 634 83.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:43:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17667-PA 162 GG17667-PA 1..162 1..162 765 95.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:43:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24240-PA 158 GH24240-PA 1..158 1..162 603 76.5 Plus
Dgri\GH22289-PA 114 GH22289-PA 1..51 1..51 151 80.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:23:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG3224-PA 162 CG3224-PA 1..162 1..162 844 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:43:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21436-PA 165 GI21436-PA 1..152 1..150 620 82.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:43:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13372-PA 164 GL13372-PA 1..164 1..162 645 80.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:43:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16779-PA 164 GA16779-PA 1..164 1..162 639 79.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:43:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12567-PA 162 GM12567-PA 1..162 1..162 853 98.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:43:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16185-PA 162 GD16185-PA 1..162 1..162 850 98.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:43:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16454-PA 165 GJ16454-PA 1..165 1..162 630 81.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:43:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25345-PA 175 GK25345-PA 1..175 1..162 643 77.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:43:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16457-PA 166 GE16457-PA 1..162 1..162 769 96.3 Plus

RE14402.hyp Sequence

Translation from 216 to 704

> RE14402.hyp
MGMVSKRKKMHYGDTHLQRRWRVRNRRRDLDQIDDDLQTRSGELINQNVD
LDKPGFAQFYCVHCAKYFIDDTAMQAHFRTKVHKRRLKALEIEPYSIEEA
ERAAGRGSFVKPKKRAMETQPSKEDVVAGKRIRVEVVPEDTDATDSPSTS
KTKRKKVEKMET*

RE14402.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:23:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG3224-PA 162 CG3224-PA 1..162 1..162 844 100 Plus