Clone RE14441 Report

Search the DGRC for RE14441

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:144
Well:41
Vector:pFlc-1
Associated Gene/TranscriptAct87E-RA
Protein status:RE14441.pep: gold
Sequenced Size:1582

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG18290 2001-12-14 Blastp of sequenced clone
CG18290 2002-01-01 Sim4 clustering to Release 2
CG18290 2003-01-01 Sim4 clustering to Release 3
Act87E 2008-04-29 Release 5.5 accounting
Act87E 2008-08-15 Release 5.9 accounting
Act87E 2008-12-18 5.12 accounting

Clone Sequence Records

RE14441.complete Sequence

1582 bp (1582 high quality bases) assembled on 2001-12-14

GenBank Submission: AY089587

> RE14441.complete
ACTCGCAGTTCTACAGCGAAAGTGTTGATTTGGATTTCTAGTTTTTCTTC
GTCTAACGTGAAAACAGCCAGTAGCCAAGATGTGTGACGATGAGGTTGCC
GCATTGGTCGTGGACAATGGTTCCGGAATGTGCAAGGCAGGATTCGCCGG
CGATGATGCGCCCCGCGCCGTCTTCCCCTCGATTGTGGGTCGTCCCCGTC
ATCAGGGCGTAATGGTGGGCATGGGACAGAAGGACTCCTATGTTGGTGAT
GAGGCCCAGAGCAAGCGTGGTATCCTCACCCTGAAATACCCCATCGAGCA
CGGCATCATCACCAACTGGGACGATATGGAGAAGATCTGGCACCACACTT
TCTATAACGAGCTGCGCGTCGCCCCCGAGGAACACCCCGTCCTGCTGACC
GAGGCCCCCCTGAACCCCAAGGCCAATCGCGAGAAGATGACCCAGATCAT
GTTCGAGACCTTCAACGCACCCGCCATGTATGTGGCCATCCAGGCTGTGC
TCTCGCTGTACGCCTCCGGTCGTACCACCGGTATTGTCCTCGACTCCGGT
GACGGTGTCTCCCACACCGTGCCCATCTACGAGGGTTACGCCCTGCCCCA
CGCCATCCTGCGTCTGGATCTGGCTGGTCGCGATTTGACCGACTACCTGA
TGAAGATCCTGACCGAGCGCGGTTACTCATTCACCACCACCGCTGAGCGT
GAAATCGTTCGCGACATCAAGGAGAAGCTGTGCTATGTTGCCCTGGACTT
TGAGCAGGAGATGGCCACCGCCGCCGCCTCCACATCCCTGGAGAAGTCAT
ACGAGCTTCCCGACGGACAGGTGATCACCATCGGCAACGAACGTTTCCGC
TGCCCAGAGTCGCTGTTCCAGCCCTCTTTCCTGGGAATGGAATCGTGCGG
CATCCACGAGACCGTGTACAACTCGATCATGAAGTGCGATGTGGACATCC
GTAAGGATCTGTATGCTAACATCGTCATGTCGGGTGGTACCACCATGTAC
CCTGGTATTGCCGATCGTATGCAGAAGGAGATCACCGCCCTGGCGCCGTC
CACCATCAAGATCAAGATCATTGCCCCACCGGAGCGCAAGTACTCCGTCT
GGATCGGTGGCTCCATCCTGGCCTCCCTGTCCACCTTCCAGCAGATGTGG
ATCTCCAAGCAGGAGTACGACGAGTCCGGCCCAGGAATCGTCCACCGCAA
GTGCTTCTAAGCGATCTAAACACCACAGACACTGCAAACCACACGGGCAT
TGAGACCCAACCACACCACGCCACAGAACACCACACAACAACAACAAGAA
CAACATGAACAGCAACAACCAAATACCAAATCAAGATCTATAGCCTAGTG
CTATTGATGATTAATCTTAAGTTAAAACCTCTTGCTGCCCTGCCATCCAA
AGAAAACCGAAGGAACCGCGATTGTAACAGCATGTATTATACTTATATTA
ATATTTATTGGAGAGCCGCTTGATGGCGCTGAAGGAGGAGTTGAGGAGAC
ACAAGAATGCAAAATTTTACAGTTTTAAAAATAAATTATACTAGCATCCT
CTATAAATTAAATCCAAAAAAAAAAAAAAAAA

RE14441.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:40:44
Subject Length Description Subject Range Query Range Score Percent Strand
Act87E-RA 1893 Act87E-RA 43..1610 1..1568 7825 99.9 Plus
Act87E.c 1893 Act87E.c 43..1610 1..1568 7825 99.9 Plus
Act87E.a 1567 Act87E.a 69..1566 67..1564 7490 100 Plus
Act87E.a 1567 Act87E.a 12..69 1..58 290 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:21:00
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 9251834..9253340 58..1564 7520 99.9 Plus
chr2R 21145070 chr2R 16831290..16832380 122..1212 4165 92.1 Plus
chrX 22417052 chrX 5795051..5796186 76..1211 4075 90.6 Plus
chr3R 27901430 chr3R 11265220..11266153 74..1007 3035 88.3 Plus
chr2R 21145070 chr2R 1901452..1902588 1212..76 2970 84.1 Minus
chr3L 24539361 chr3L 21974285..21975211 80..1006 2880 87.4 Plus
chr3R 27901430 chr3R 11266211..11266418 1004..1211 830 93.3 Plus
chr3L 24539361 chr3L 21975571..21975779 1004..1212 775 91.4 Plus
chr3R 27901430 chr3R 9251223..9251280 1..58 290 100 Plus
chr2R 21145070 chr2R 12661960..12662166 398..604 255 74.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:36:24 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:20:58
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13426582..13428092 58..1568 7540 99.9 Plus
2R 25286936 2R 20944846..20945936 122..1212 4165 92.1 Plus
X 23542271 X 5902694..5903829 76..1211 4090 90.7 Plus
3R 32079331 3R 15440610..15441543 74..1007 3020 88.2 Plus
2R 25286936 2R 6014268..6015404 1212..76 2970 84.1 Minus
3L 28110227 3L 21985351..21986277 80..1006 2880 87.4 Plus
3R 32079331 3R 15441601..15441808 1004..1211 830 93.3 Plus
3L 28110227 3L 21986637..21986845 1004..1212 775 91.4 Plus
3R 32079331 3R 13425985..13426042 1..58 290 100 Plus
2R 25286936 2R 16774750..16774956 398..604 255 74.9 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:07:47
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 13167413..13168923 58..1568 7540 99.9 Plus
2R 25260384 2R 20946045..20947135 122..1212 4165 92.1 Plus
3R 31820162 3R 15181441..15182374 74..1007 3020 88.2 Plus
3L 28103327 3L 21978451..21979377 80..1006 2880 87.3 Plus
X 23527363 X 5910792..5911491 76..775 2630 91.7 Plus
2R 25260384 2R 6015905..6016603 774..76 1965 85.4 Minus
X 23527363 X 5911505..5911927 789..1211 1515 90.5 Plus
2R 25260384 2R 6015467..6015894 1212..785 1060 83.1 Minus
3R 31820162 3R 15182432..15182639 1004..1211 830 93.2 Plus
3L 28103327 3L 21979737..21979945 1004..1212 775 91.3 Plus
3R 31820162 3R 13166816..13166873 1..58 290 100 Plus
2R 25260384 2R 16776042..16776155 491..604 210 78.9 Plus
2R 25260384 2R 16775832..16775902 278..348 145 80.2 Plus
2R 25260384 2R 16775652..16775743 98..189 145 77.1 Plus
2R 25260384 2R 20945312..20945357 76..121 140 86.9 Plus
Blast to na_te.dros performed on 2019-03-16 19:20:58 has no hits.

RE14441.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:21:59 Download gff for RE14441.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 9251223..9251280 1..58 100 -> Plus
chr3R 9251835..9253340 59..1565 97   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:56:24 Download gff for RE14441.complete
Subject Subject Range Query Range Percent Splice Strand
Act87E-RB 1..1131 80..1210 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:05:33 Download gff for RE14441.complete
Subject Subject Range Query Range Percent Splice Strand
Act87E-RB 1..1131 80..1210 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:36:50 Download gff for RE14441.complete
Subject Subject Range Query Range Percent Splice Strand
Act87E-RA 1..1131 80..1210 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:30:09 Download gff for RE14441.complete
Subject Subject Range Query Range Percent Splice Strand
Act87E-RB 1..1131 80..1210 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:27:51 Download gff for RE14441.complete
Subject Subject Range Query Range Percent Splice Strand
Act87E-RA 1..1131 80..1210 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:33:27 Download gff for RE14441.complete
Subject Subject Range Query Range Percent Splice Strand
Act87E-RA 1..1564 1..1565 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:05:33 Download gff for RE14441.complete
Subject Subject Range Query Range Percent Splice Strand
Act87E-RA 1..1564 1..1565 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:36:50 Download gff for RE14441.complete
Subject Subject Range Query Range Percent Splice Strand
Act87E-RA 1..1564 1..1565 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:30:09 Download gff for RE14441.complete
Subject Subject Range Query Range Percent Splice Strand
Act87E-RA 1..1564 1..1564 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:27:51 Download gff for RE14441.complete
Subject Subject Range Query Range Percent Splice Strand
Act87E-RA 3..1566 1..1565 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:21:59 Download gff for RE14441.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13425985..13426042 1..58 100 -> Plus
3R 13426583..13428088 59..1565 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:21:59 Download gff for RE14441.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13425985..13426042 1..58 100 -> Plus
3R 13426583..13428088 59..1565 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:21:59 Download gff for RE14441.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13425985..13426042 1..58 100 -> Plus
3R 13426583..13428088 59..1565 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:36:50 Download gff for RE14441.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9251707..9251764 1..58 100 -> Plus
arm_3R 9252305..9253810 59..1565 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:06:21 Download gff for RE14441.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13167414..13168919 59..1565 99   Plus
3R 13166816..13166873 1..58 100 -> Plus

RE14441.hyp Sequence

Translation from 79 to 1209

> RE14441.hyp
MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQ
KDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPE
EHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTT
GIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYS
FTTTAEREIVRDIKEKLCYVALDFEQEMATAAASTSLEKSYELPDGQVIT
IGNERFRCPESLFQPSFLGMESCGIHETVYNSIMKCDVDIRKDLYANIVM
SGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGSILASL
STFQQMWISKQEYDESGPGIVHRKCF*

RE14441.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:09:38
Subject Length Description Subject Range Query Range Score Percent Strand
Act87E-PC 376 CG18290-PC 1..376 1..376 1967 100 Plus
Act87E-PB 376 CG18290-PB 1..376 1..376 1967 100 Plus
Act87E-PA 376 CG18290-PA 1..376 1..376 1967 100 Plus
Act57B-PA 376 CG10067-PA 1..376 1..376 1958 99.2 Plus
Act88F-PA 376 CG5178-PA 1..376 1..376 1936 97.6 Plus

RE14441.pep Sequence

Translation from 79 to 1209

> RE14441.pep
MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQ
KDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPE
EHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTT
GIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYS
FTTTAEREIVRDIKEKLCYVALDFEQEMATAAASTSLEKSYELPDGQVIT
IGNERFRCPESLFQPSFLGMESCGIHETVYNSIMKCDVDIRKDLYANIVM
SGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGSILASL
STFQQMWISKQEYDESGPGIVHRKCF*

RE14441.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:38:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17602-PA 376 GF17602-PA 1..376 1..376 2030 100 Plus
Dana\GF12208-PA 376 GF12208-PA 1..376 1..376 2019 99.2 Plus
Dana\GF18300-PA 376 GF18300-PA 1..376 1..376 1996 97.6 Plus
Dana\GF13827-PA 376 GF13827-PA 1..376 1..376 1983 96.5 Plus
Dana\GF10940-PA 376 GF10940-PA 1..376 1..376 1977 96.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:38:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19688-PA 376 GG19688-PA 1..376 1..376 2030 100 Plus
Dere\GG22068-PA 376 GG22068-PA 1..376 1..376 2019 99.2 Plus
Dere\GG16929-PA 376 GG16929-PA 1..376 1..376 1996 97.6 Plus
Dere\GG10840-PA 376 GG10840-PA 1..376 1..376 1992 96.8 Plus
Dere\GG18797-PA 376 GG18797-PA 1..376 1..376 1987 96.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:38:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19045-PA 376 GH19045-PA 1..376 1..376 2030 100 Plus
Dgri\GH22007-PA 376 GH22007-PA 1..376 1..376 2019 99.2 Plus
Dgri\GH24372-PA 376 GH24372-PA 1..376 1..376 1987 96.8 Plus
Dgri\GH20408-PA 376 GH20408-PA 1..376 1..376 1987 96.5 Plus
Dgri\GH19077-PA 376 GH19077-PA 1..376 1..376 1987 97.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:40:19
Subject Length Description Subject Range Query Range Score Percent Strand
Act87E-PC 376 CG18290-PC 1..376 1..376 1967 100 Plus
Act87E-PB 376 CG18290-PB 1..376 1..376 1967 100 Plus
Act87E-PA 376 CG18290-PA 1..376 1..376 1967 100 Plus
Act57B-PA 376 CG10067-PA 1..376 1..376 1958 99.2 Plus
Act88F-PA 376 CG5178-PA 1..376 1..376 1936 97.6 Plus
Act42A-PA 376 CG12051-PA 1..376 1..376 1926 96.8 Plus
Act5C-PE 376 CG4027-PE 1..376 1..376 1924 96.8 Plus
Act5C-PD 376 CG4027-PD 1..376 1..376 1924 96.8 Plus
Act5C-PC 376 CG4027-PC 1..376 1..376 1924 96.8 Plus
Act5C-PA 376 CG4027-PA 1..376 1..376 1924 96.8 Plus
Act5C-PB 376 CG4027-PB 1..376 1..376 1924 96.8 Plus
Act79B-PB 376 CG7478-PB 1..376 1..376 1914 96.8 Plus
Act79B-PA 376 CG7478-PA 1..376 1..376 1914 96.8 Plus
Arp53D-PB 411 CG5409-PB 47..411 7..376 1274 64.3 Plus
Arp1-PA 376 CG6174-PA 12..376 9..376 1084 54.6 Plus
Arp2-PB 394 CG9901-PB 9..388 9..373 917 47.1 Plus
Arp2-PA 394 CG9901-PA 9..388 9..373 917 47.1 Plus
Arp2-PC 399 CG9901-PC 9..393 9..373 908 46.2 Plus
Arp3-PB 418 CG7558-PB 7..407 8..370 648 35.8 Plus
Arp3-PA 418 CG7558-PA 7..407 8..370 648 35.8 Plus
Bap55-PA 425 CG6546-PA 11..424 4..375 581 32.9 Plus
Arp6-PA 398 CG11678-PA 4..391 7..367 421 26.4 Plus
Arp5-PB 648 CG7940-PB 7..246 9..228 219 22.9 Plus
Arp5-PA 648 CG7940-PA 7..246 9..228 219 22.9 Plus
Arp10-PB 378 CG12235-PB 10..361 5..366 210 21.6 Plus
Arp10-PA 378 CG12235-PA 10..361 5..366 210 21.6 Plus
Arp5-PB 648 CG7940-PB 514..629 252..367 158 29.3 Plus
Arp5-PA 648 CG7940-PA 514..629 252..367 158 29.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:38:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24339-PA 376 GI24339-PA 1..376 1..376 2030 100 Plus
Dmoj\GI19711-PA 376 GI19711-PA 1..376 1..376 2019 99.2 Plus
Dmoj\GI19595-PA 376 GI19595-PA 1..376 1..376 1988 96.5 Plus
Dmoj\GI23222-PA 376 GI23222-PA 1..376 1..376 1987 97.3 Plus
Dmoj\GI15312-PA 376 GI15312-PA 1..376 1..376 1987 96.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:38:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17061-PA 376 GL17061-PA 1..376 1..376 2019 99.2 Plus
Dper\GL17787-PA 376 GL17787-PA 1..376 1..376 1987 96.5 Plus
Dper\GL14888-PA 376 GL14888-PA 1..376 1..376 1987 96.8 Plus
Dper\GL26327-PA 376 GL26327-PA 1..376 1..376 1949 94.4 Plus
Dper\GL23756-PA 371 GL23756-PA 1..371 1..376 1703 86.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:38:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14877-PB 376 GA14877-PB 1..376 1..376 2030 100 Plus
Dpse\GA14877-PA 376 GA14877-PA 1..376 1..376 2030 100 Plus
Dpse\GA24346-PA 376 GA24346-PA 1..376 1..376 2019 99.2 Plus
Dpse\GA26730-PA 376 GA26730-PA 1..376 1..376 1996 97.6 Plus
Dpse\GA24908-PB 376 GA24908-PB 1..376 1..376 1987 96.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:38:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24109-PA 376 GM24109-PA 1..376 1..376 1995 98.7 Plus
Dsec\GM16492-PA 376 GM16492-PA 1..376 1..376 1992 96.8 Plus
Dsec\GM12447-PA 376 GM12447-PA 1..376 1..376 1987 96.8 Plus
Dsec\GM22426-PA 376 GM22426-PA 1..376 1..376 1977 96.8 Plus
Dsec\GM21720-PA 376 GM21720-PA 12..376 7..376 1329 64.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:38:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18909-PA 376 GD18909-PA 1..376 1..376 2030 100 Plus
Dsim\GD11548-PA 376 GD11548-PA 1..376 1..376 2019 99.2 Plus
Dsim\Act88F-PA 376 GD19025-PA 1..376 1..376 1996 97.6 Plus
Dsim\GD10342-PA 376 GD10342-PA 1..376 1..376 1992 96.8 Plus
Dsim\GD16764-PA 376 GD16764-PA 1..376 1..376 1987 96.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:38:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\ActE1-PA 376 GJ10425-PA 1..376 1..376 2030 100 Plus
Dvir\ActC2-PA 376 GJ17479-PA 1..376 1..376 2019 99.2 Plus
Dvir\GJ18395-PA 376 GJ18395-PA 1..376 1..376 1988 96.5 Plus
Dvir\GJ14747-PA 376 GJ14747-PA 1..376 1..376 1987 96.8 Plus
Dvir\ActE2-PA 376 GJ22881-PA 1..376 1..376 1987 97.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:39:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13943-PA 376 GK13943-PA 1..376 1..376 2030 100 Plus
Dwil\GK23336-PA 376 GK23336-PA 1..376 1..376 2019 99.2 Plus
Dwil\GK11462-PA 376 GK11462-PA 1..376 1..376 1996 97.6 Plus
Dwil\GK21751-PA 376 GK21751-PA 1..376 1..376 1992 96.8 Plus
Dwil\GK20124-PA 376 GK20124-PA 1..376 1..376 1987 96.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:39:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26273-PA 376 GE26273-PA 1..376 1..376 2030 100 Plus
Dyak\GE12149-PA 376 GE12149-PA 1..376 1..376 2019 99.2 Plus
Dyak\GE24312-PA 376 GE24312-PA 1..376 1..376 1996 97.6 Plus
Dyak\GE19434-PA 376 GE19434-PA 1..376 1..376 1988 96.5 Plus
Dyak\Act57B-PA 376 GE17558-PA 1..376 1..376 1987 96.8 Plus