Clone RE14575 Report

Search the DGRC for RE14575

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:145
Well:75
Vector:pFlc-1
Associated Gene/TranscriptGip-RA
Protein status:RE14575.pep: gold
Preliminary Size:936
Sequenced Size:989

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2227 2001-12-14 Blastp of sequenced clone
CG2227 2002-01-01 Sim4 clustering to Release 2
CG2227 2003-01-01 Sim4 clustering to Release 3
Gip 2008-04-29 Release 5.5 accounting
Gip 2008-08-15 Release 5.9 accounting
Gip 2008-12-18 5.12 accounting

Clone Sequence Records

RE14575.complete Sequence

989 bp (989 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071075

> RE14575.complete
AGGTATAATATAAAAAACGGGTAATCGCATCGTTCCCCCCCAGTTGTTTG
CCAAGCGTGAACGCAGGCGGAGATTAGTGAACGGAAGATGGCACTCAAGT
TTGCAGCGAATCTGAACTTTTTGTTCACGGAAAGAGCGACGTCGATCGCG
GAGCGAATTCGTCTGGCCCACCAGAACGGATTCCGTGCGGTAGAGATCCC
CTATCCCGAAGGCGAGACGAGCGACGTGGTGTCCGCCGTAAAGGAGACGG
GTGTGGTGGTCAGTCTGGTGAATCTGGCCTTCGACAAGAGCGACGATCAG
CTGCGTTTCGGCTCCACCAGTGTGCCCGGCTCGGAAAAGCTGTTCCGTAG
CCAATTGGATGCCACCATTGATTTCGCCCGACAGGTTAACTGTGGCAAGA
TTCATCTAACCGCTGGACTCTTCAAGGGCGGCCAGGAGAGTGACTACACG
AAGACGTATACCGCCAATCTAAAGATCGCCGCCGATAGCCTTAGAGCCAG
TAAAATGATCGGCGTGATAGAGCCAATTAACAAGTACGCCGTGCCTGGCT
ACTACATGAATTCATACTCCAAAGCCGCTGGAATTCTGGCCGATGTGGCT
GCGGACAACATTCAATTGCTGGCCGATCTGTATCACCTGCAGCATTTGCA
CGGCAACGTTTCCAAGACGCTCGAGGAGTACAAGGCGCTGATTGGACACT
TTCAGATCGCCCAGGTGCCGCATCGCCACGAGCCGGATGTTTCCGGTGAG
CTGGACTACGGATTTGTGTTCAAGGCTCTCCAGGAATTCGGCTATGATGG
ATGGATCGGTTGCGAGTACAAGCCGAAGACGACCACTGTCGAGGGTTTGG
GTTGGGTCTCCAAATTGGGCTACACGCTATAATTATCACATCACATATAG
TTTGGCATAAGGAACTGCTCTGCATTTATACACATGTATTTACACTGCTT
ACAAACATAAAGATGGTTTAACCAAAAAAAAAAAAAAAA

RE14575.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:46:41
Subject Length Description Subject Range Query Range Score Percent Strand
Gip-RA 973 Gip-RA 4..973 4..973 4850 100 Plus
CG2909-RA 2103 CG2909-RA 1988..2103 977..862 580 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:09:42
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 10220348..10221317 973..4 4805 99.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:36:30 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:09:40
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 10328873..10329846 977..4 4870 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:13:06
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 10336971..10337944 977..4 4870 100 Minus
Blast to na_te.dros performed on 2019-03-16 03:09:40 has no hits.

RE14575.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:10:45 Download gff for RE14575.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 10220348..10221320 1..973 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:56:30 Download gff for RE14575.complete
Subject Subject Range Query Range Percent Splice Strand
Gip-RA 1..795 88..882 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:14:13 Download gff for RE14575.complete
Subject Subject Range Query Range Percent Splice Strand
Gip-RA 1..795 88..882 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:42:50 Download gff for RE14575.complete
Subject Subject Range Query Range Percent Splice Strand
Gip-RA 1..795 88..882 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:39:32 Download gff for RE14575.complete
Subject Subject Range Query Range Percent Splice Strand
Gip-RA 1..795 88..882 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:32:42 Download gff for RE14575.complete
Subject Subject Range Query Range Percent Splice Strand
Gip-RA 1..795 88..882 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:45:42 Download gff for RE14575.complete
Subject Subject Range Query Range Percent Splice Strand
Gip-RA 1..973 1..973 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:14:13 Download gff for RE14575.complete
Subject Subject Range Query Range Percent Splice Strand
Gip-RA 1..973 1..973 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:42:50 Download gff for RE14575.complete
Subject Subject Range Query Range Percent Splice Strand
Gip-RA 1..973 1..973 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:39:32 Download gff for RE14575.complete
Subject Subject Range Query Range Percent Splice Strand
Gip-RA 1..973 1..973 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:32:42 Download gff for RE14575.complete
Subject Subject Range Query Range Percent Splice Strand
Gip-RA 24..996 1..973 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:10:45 Download gff for RE14575.complete
Subject Subject Range Query Range Percent Splice Strand
X 10328877..10329849 1..973 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:10:45 Download gff for RE14575.complete
Subject Subject Range Query Range Percent Splice Strand
X 10328877..10329849 1..973 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:10:45 Download gff for RE14575.complete
Subject Subject Range Query Range Percent Splice Strand
X 10328877..10329849 1..973 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:42:50 Download gff for RE14575.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 10222910..10223882 1..973 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:16:09 Download gff for RE14575.complete
Subject Subject Range Query Range Percent Splice Strand
X 10336975..10337947 1..973 99   Minus

RE14575.pep Sequence

Translation from 87 to 881

> RE14575.pep
MALKFAANLNFLFTERATSIAERIRLAHQNGFRAVEIPYPEGETSDVVSA
VKETGVVVSLVNLAFDKSDDQLRFGSTSVPGSEKLFRSQLDATIDFARQV
NCGKIHLTAGLFKGGQESDYTKTYTANLKIAADSLRASKMIGVIEPINKY
AVPGYYMNSYSKAAGILADVAADNIQLLADLYHLQHLHGNVSKTLEEYKA
LIGHFQIAQVPHRHEPDVSGELDYGFVFKALQEFGYDGWIGCEYKPKTTT
VEGLGWVSKLGYTL*

RE14575.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:23:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19487-PA 264 GF19487-PA 1..264 1..264 1297 89 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:23:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18931-PA 264 GG18931-PA 1..264 1..264 1396 98.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:23:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18029-PA 264 GH18029-PA 1..259 1..259 932 61.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:24:20
Subject Length Description Subject Range Query Range Score Percent Strand
Gip-PA 264 CG2227-PA 1..264 1..264 1363 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:23:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23817-PA 263 GI23817-PA 2..258 3..259 866 61.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:23:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26790-PA 264 GL26790-PA 1..264 1..264 1218 82.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:23:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15314-PA 264 GA15314-PA 1..264 1..264 1218 82.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:23:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11322-PA 264 GM11322-PA 1..264 1..264 1400 98.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:23:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12017-PA 212 GD12017-PA 1..173 1..173 905 99.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:23:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23596-PA 261 GJ23596-PA 1..256 3..259 896 59.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:23:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24933-PA 264 GK24933-PA 1..264 1..264 1072 71.2 Plus
Dwil\GK18837-PA 267 GK18837-PA 1..267 1..264 932 62.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:23:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Gip-PA 264 GE15402-PA 1..264 1..264 1392 97.7 Plus

RE14575.hyp Sequence

Translation from 87 to 881

> RE14575.hyp
MALKFAANLNFLFTERATSIAERIRLAHQNGFRAVEIPYPEGETSDVVSA
VKETGVVVSLVNLAFDKSDDQLRFGSTSVPGSEKLFRSQLDATIDFARQV
NCGKIHLTAGLFKGGQESDYTKTYTANLKIAADSLRASKMIGVIEPINKY
AVPGYYMNSYSKAAGILADVAADNIQLLADLYHLQHLHGNVSKTLEEYKA
LIGHFQIAQVPHRHEPDVSGELDYGFVFKALQEFGYDGWIGCEYKPKTTT
VEGLGWVSKLGYTL*

RE14575.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:48:27
Subject Length Description Subject Range Query Range Score Percent Strand
Gip-PA 264 CG2227-PA 1..264 1..264 1363 100 Plus