Clone RE14595 Report

Search the DGRC for RE14595

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:145
Well:95
Vector:pFlc-1
Associated Gene/TranscriptRpS25-RA
Protein status:RE14595.pep: gold
Preliminary Size:547
Sequenced Size:553

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6684 2001-12-17 Blastp of sequenced clone
CG6684 2002-01-01 Sim4 clustering to Release 2
RpS25 2008-04-29 Release 5.5 accounting
RpS25 2008-08-15 Release 5.9 accounting
RpS25 2008-12-18 5.12 accounting

Clone Sequence Records

RE14595.complete Sequence

553 bp (553 high quality bases) assembled on 2001-12-17

GenBank Submission: AY071076

> RE14595.complete
GGATGGTAACTCTGGCCGTTTCCGCCCTCCATCTTTCTGCATTGACTTTT
CACGATGCCGCCTAAGAAGGACGCGAAGTCTTCGGCCAAGCAGCCGCAAA
AGACACAAAAGAAGAAGGAGGGATCCGGCGGCGGCAAGGCCAAGAAGAAG
AAGTGGTCCAAGGGAAAAGTCAGGGACAAGCTGAACAACCAGGTGCTGTT
CGACAAGGCCACCTACGAGAAGCTGTACAAGGAAGTGCCCGCCTACAAGC
TGATCACCCCATCGGTGGTCTCCGAGCGTCTGAAGATCCGCGGCTCCCTG
GCCAAGCGTGCTCTCATCGAGCTGCGCGAGAAGGGTCTGATCAAGCAGGT
CGTGCAGCATCATTCCCAGGTCATCTACACACGTGCCACCAAGGGTGATG
AGGCGTAAATGAATGTTTTACCTTTTGCCCATCTCGCATCGCCGTAGTCG
CACTCGCCTTACAATAGAACTCTGTATCGATAGCACTACGATGCCGCTGT
GTGTGTAACGTTGAATAAACTTGCTTTCTTATTGATGTAAAAAAAAAAAA
AAA

RE14595.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:42:35
Subject Length Description Subject Range Query Range Score Percent Strand
RpS25-RB 859 RpS25-RB 131..670 1..540 2700 100 Plus
RpS25-RA 686 RpS25-RA 1..536 1..536 2680 100 Plus
RpS25.a 821 RpS25.a 1..283 1..283 1415 100 Plus
RpS25.a 821 RpS25.a 278..479 335..536 1010 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:51:55
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 7041274..7041553 336..57 1400 100 Minus
chr3R 27901430 chr3R 7041004..7041208 538..334 1025 100 Minus
chr3R 27901430 chr3R 7041842..7041898 57..1 285 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:36:32 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:51:54
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11215691..11215970 336..57 1400 100 Minus
3R 32079331 3R 11215419..11215625 540..334 1035 100 Minus
3R 32079331 3R 11216259..11216315 57..1 285 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:15:48
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 10956522..10956801 336..57 1400 100 Minus
3R 31820162 3R 10956250..10956456 540..334 1035 100 Minus
3R 31820162 3R 10957090..10957146 57..1 285 100 Minus
Blast to na_te.dros performed on 2019-03-16 18:51:54 has no hits.

RE14595.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:53:00 Download gff for RE14595.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 7041004..7041207 335..538 100 <- Minus
chr3R 7041276..7041552 58..334 100 <- Minus
chr3R 7041842..7041898 1..57 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:56:32 Download gff for RE14595.complete
Subject Subject Range Query Range Percent Splice Strand
RpS25-RB 1..354 55..408 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:15:40 Download gff for RE14595.complete
Subject Subject Range Query Range Percent Splice Strand
RpS25-RB 1..354 55..408 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:18:04 Download gff for RE14595.complete
Subject Subject Range Query Range Percent Splice Strand
RpS25-RA 1..354 55..408 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:06:35 Download gff for RE14595.complete
Subject Subject Range Query Range Percent Splice Strand
RpS25-RB 1..354 55..408 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:52:44 Download gff for RE14595.complete
Subject Subject Range Query Range Percent Splice Strand
RpS25-RA 1..354 55..408 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:39:23 Download gff for RE14595.complete
Subject Subject Range Query Range Percent Splice Strand
RpS25-RB 1..538 1..538 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:15:39 Download gff for RE14595.complete
Subject Subject Range Query Range Percent Splice Strand
RpS25-RB 1..538 1..538 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:18:04 Download gff for RE14595.complete
Subject Subject Range Query Range Percent Splice Strand
RpS25-RB 1..510 29..538 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:06:35 Download gff for RE14595.complete
Subject Subject Range Query Range Percent Splice Strand
RpS25-RB 1..538 1..538 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:52:44 Download gff for RE14595.complete
Subject Subject Range Query Range Percent Splice Strand
RpS25-RB 1..510 29..538 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:53:00 Download gff for RE14595.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11215693..11215969 58..334 100 <- Minus
3R 11216259..11216315 1..57 100   Minus
3R 11215421..11215624 335..538 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:53:00 Download gff for RE14595.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11215693..11215969 58..334 100 <- Minus
3R 11216259..11216315 1..57 100   Minus
3R 11215421..11215624 335..538 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:53:00 Download gff for RE14595.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11215693..11215969 58..334 100 <- Minus
3R 11216259..11216315 1..57 100   Minus
3R 11215421..11215624 335..538 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:18:04 Download gff for RE14595.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7041415..7041691 58..334 100 <- Minus
arm_3R 7041981..7042037 1..57 100   Minus
arm_3R 7041143..7041346 335..538 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:38:38 Download gff for RE14595.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10956524..10956800 58..334 100 <- Minus
3R 10957090..10957146 1..57 100   Minus
3R 10956252..10956455 335..538 100 <- Minus

RE14595.pep Sequence

Translation from 54 to 407

> RE14595.pep
MPPKKDAKSSAKQPQKTQKKKEGSGGGKAKKKKWSKGKVRDKLNNQVLFD
KATYEKLYKEVPAYKLITPSVVSERLKIRGSLAKRALIELREKGLIKQVV
QHHSQVIYTRATKGDEA*

RE14595.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 04:10:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18256-PA 117 GF18256-PA 1..117 1..117 593 100 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 04:10:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17238-PA 117 GG17238-PA 1..117 1..117 593 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 04:10:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19325-PA 117 GH19325-PA 1..117 1..117 593 100 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:21:19
Subject Length Description Subject Range Query Range Score Percent Strand
RpS25-PB 117 CG6684-PB 1..117 1..117 591 100 Plus
RpS25-PA 117 CG6684-PA 1..117 1..117 591 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 04:10:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23935-PA 117 GI23935-PA 1..117 1..117 593 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 04:10:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12038-PA 117 GL12038-PA 1..117 1..117 582 98.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 04:10:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26170-PA 117 GA26170-PA 1..117 1..117 582 98.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 04:10:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26117-PA 117 GM26117-PA 1..117 1..117 593 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 04:10:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20677-PA 117 GD20677-PA 1..117 1..117 593 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 04:10:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10295-PA 117 GJ10295-PA 1..117 1..117 593 100 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 04:10:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13272-PA 117 GK13272-PA 1..117 1..117 593 100 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 04:10:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\RpS25-PA 117 GE24638-PA 1..117 1..117 593 100 Plus

RE14595.hyp Sequence

Translation from 54 to 407

> RE14595.hyp
MPPKKDAKSSAKQPQKTQKKKEGSGGGKAKKKKWSKGKVRDKLNNQVLFD
KATYEKLYKEVPAYKLITPSVVSERLKIRGSLAKRALIELREKGLIKQVV
QHHSQVIYTRATKGDEA*

RE14595.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:30:41
Subject Length Description Subject Range Query Range Score Percent Strand
RpS25-PB 117 CG6684-PB 1..117 1..117 591 100 Plus
RpS25-PA 117 CG6684-PA 1..117 1..117 591 100 Plus