BDGP Sequence Production Resources |
Search the DGRC for RE14595
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 145 |
Well: | 95 |
Vector: | pFlc-1 |
Associated Gene/Transcript | RpS25-RA |
Protein status: | RE14595.pep: gold |
Preliminary Size: | 547 |
Sequenced Size: | 553 |
Gene | Date | Evidence |
---|---|---|
CG6684 | 2001-12-17 | Blastp of sequenced clone |
CG6684 | 2002-01-01 | Sim4 clustering to Release 2 |
RpS25 | 2008-04-29 | Release 5.5 accounting |
RpS25 | 2008-08-15 | Release 5.9 accounting |
RpS25 | 2008-12-18 | 5.12 accounting |
553 bp (553 high quality bases) assembled on 2001-12-17
GenBank Submission: AY071076
> RE14595.complete GGATGGTAACTCTGGCCGTTTCCGCCCTCCATCTTTCTGCATTGACTTTT CACGATGCCGCCTAAGAAGGACGCGAAGTCTTCGGCCAAGCAGCCGCAAA AGACACAAAAGAAGAAGGAGGGATCCGGCGGCGGCAAGGCCAAGAAGAAG AAGTGGTCCAAGGGAAAAGTCAGGGACAAGCTGAACAACCAGGTGCTGTT CGACAAGGCCACCTACGAGAAGCTGTACAAGGAAGTGCCCGCCTACAAGC TGATCACCCCATCGGTGGTCTCCGAGCGTCTGAAGATCCGCGGCTCCCTG GCCAAGCGTGCTCTCATCGAGCTGCGCGAGAAGGGTCTGATCAAGCAGGT CGTGCAGCATCATTCCCAGGTCATCTACACACGTGCCACCAAGGGTGATG AGGCGTAAATGAATGTTTTACCTTTTGCCCATCTCGCATCGCCGTAGTCG CACTCGCCTTACAATAGAACTCTGTATCGATAGCACTACGATGCCGCTGT GTGTGTAACGTTGAATAAACTTGCTTTCTTATTGATGTAAAAAAAAAAAA AAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpS25-RB | 859 | RpS25-RB | 131..670 | 1..540 | 2700 | 100 | Plus |
RpS25-RA | 686 | RpS25-RA | 1..536 | 1..536 | 2680 | 100 | Plus |
RpS25.a | 821 | RpS25.a | 1..283 | 1..283 | 1415 | 100 | Plus |
RpS25.a | 821 | RpS25.a | 278..479 | 335..536 | 1010 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 7041274..7041553 | 336..57 | 1400 | 100 | Minus |
chr3R | 27901430 | chr3R | 7041004..7041208 | 538..334 | 1025 | 100 | Minus |
chr3R | 27901430 | chr3R | 7041842..7041898 | 57..1 | 285 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 11215691..11215970 | 336..57 | 1400 | 100 | Minus |
3R | 32079331 | 3R | 11215419..11215625 | 540..334 | 1035 | 100 | Minus |
3R | 32079331 | 3R | 11216259..11216315 | 57..1 | 285 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 10956522..10956801 | 336..57 | 1400 | 100 | Minus |
3R | 31820162 | 3R | 10956250..10956456 | 540..334 | 1035 | 100 | Minus |
3R | 31820162 | 3R | 10957090..10957146 | 57..1 | 285 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 7041004..7041207 | 335..538 | 100 | <- | Minus |
chr3R | 7041276..7041552 | 58..334 | 100 | <- | Minus |
chr3R | 7041842..7041898 | 1..57 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS25-RB | 1..354 | 55..408 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS25-RB | 1..354 | 55..408 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS25-RA | 1..354 | 55..408 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS25-RB | 1..354 | 55..408 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS25-RA | 1..354 | 55..408 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS25-RB | 1..538 | 1..538 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS25-RB | 1..538 | 1..538 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS25-RB | 1..510 | 29..538 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS25-RB | 1..538 | 1..538 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS25-RB | 1..510 | 29..538 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 11215693..11215969 | 58..334 | 100 | <- | Minus |
3R | 11216259..11216315 | 1..57 | 100 | Minus | |
3R | 11215421..11215624 | 335..538 | 100 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 11215693..11215969 | 58..334 | 100 | <- | Minus |
3R | 11216259..11216315 | 1..57 | 100 | Minus | |
3R | 11215421..11215624 | 335..538 | 100 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 11215693..11215969 | 58..334 | 100 | <- | Minus |
3R | 11216259..11216315 | 1..57 | 100 | Minus | |
3R | 11215421..11215624 | 335..538 | 100 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 7041415..7041691 | 58..334 | 100 | <- | Minus |
arm_3R | 7041981..7042037 | 1..57 | 100 | Minus | |
arm_3R | 7041143..7041346 | 335..538 | 100 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 10956524..10956800 | 58..334 | 100 | <- | Minus |
3R | 10957090..10957146 | 1..57 | 100 | Minus | |
3R | 10956252..10956455 | 335..538 | 100 | <- | Minus |
Translation from 54 to 407
> RE14595.pep MPPKKDAKSSAKQPQKTQKKKEGSGGGKAKKKKWSKGKVRDKLNNQVLFD KATYEKLYKEVPAYKLITPSVVSERLKIRGSLAKRALIELREKGLIKQVV QHHSQVIYTRATKGDEA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF18256-PA | 117 | GF18256-PA | 1..117 | 1..117 | 593 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG17238-PA | 117 | GG17238-PA | 1..117 | 1..117 | 593 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH19325-PA | 117 | GH19325-PA | 1..117 | 1..117 | 593 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpS25-PB | 117 | CG6684-PB | 1..117 | 1..117 | 591 | 100 | Plus |
RpS25-PA | 117 | CG6684-PA | 1..117 | 1..117 | 591 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI23935-PA | 117 | GI23935-PA | 1..117 | 1..117 | 593 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL12038-PA | 117 | GL12038-PA | 1..117 | 1..117 | 582 | 98.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA26170-PA | 117 | GA26170-PA | 1..117 | 1..117 | 582 | 98.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM26117-PA | 117 | GM26117-PA | 1..117 | 1..117 | 593 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD20677-PA | 117 | GD20677-PA | 1..117 | 1..117 | 593 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ10295-PA | 117 | GJ10295-PA | 1..117 | 1..117 | 593 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK13272-PA | 117 | GK13272-PA | 1..117 | 1..117 | 593 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\RpS25-PA | 117 | GE24638-PA | 1..117 | 1..117 | 593 | 100 | Plus |
Translation from 54 to 407
> RE14595.hyp MPPKKDAKSSAKQPQKTQKKKEGSGGGKAKKKKWSKGKVRDKLNNQVLFD KATYEKLYKEVPAYKLITPSVVSERLKIRGSLAKRALIELREKGLIKQVV QHHSQVIYTRATKGDEA*