Clone RE14725 Report

Search the DGRC for RE14725

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:147
Well:25
Vector:pFlc-1
Associated Gene/TranscriptCG3446-RA
Protein status:RE14725.pep: gold
Sequenced Size:915

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3446 2001-12-14 Blastp of sequenced clone
CG3446 2002-01-01 Sim4 clustering to Release 2
CG3446 2003-01-01 Sim4 clustering to Release 3
CG3446 2008-04-29 Release 5.5 accounting
CG3446 2008-08-15 Release 5.9 accounting
CG3446 2008-12-18 5.12 accounting

Clone Sequence Records

RE14725.complete Sequence

915 bp (915 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071078

> RE14725.complete
ACTAGTTGGTATTTTACCCTGCCCCAAGTCAGGCCACACTGCCTTGGTGT
TATGCAAAAAACGTCATTTTTTTGACAATTCAACAGATTTTTTCCCTTTA
TTCGAGCGAGGAGTCACCATGGCGACGGCAGTGCCGCATTGTCCCCCGAA
ACAGGACCTTCCACCGCCGGGCGGCTACAAGAAGATACCCTTTGCCCGCG
TGCCACCGAAGAGCTACTTCACAGGCTTCACCACCATCGGCACCTATGTG
GTTGTGACAGCCGTTGGCCTGGGCATCTACTACTTGACCGCCAAGAAGGT
GAAGCGCGACGAGATCGAGATGCGTTCCGCCCAGAATGTCATCTTTCCCA
TTTTGGTCGCCGAGCGGGATCGCGAATTCCTGCGCCAGTTGCGACGCAAT
CGGGACGAGGAGGCCGAGCTGATGAAGAACGTGCCCGGCTGGGAGGTGGG
CACCTGGTATGGTGAGCCCGTTTTCAAGACCCTGCCCGAGGATACCCTGG
TCACGCCCATTTTCAAGGAGTTCTACGCCCACTCCGACTGGAAGTCGTAC
GCCAAGCGTGCCCACTTGAAGCTCTGGTCCTAAATCGGCCTAGTTAATGG
ATTAGTTAATGCCTAAGCACGCACCTTTTTGTTTGTAGATCATCCGCCTA
AGCGCCAAAAAAAGAAAGTATCGACCAATTATAATGTCAGATCAGATTGG
CTGAAATACCGATTCTCTTTGTGTGTGTTTAATCCAAATCCTGTGCTGGA
CCACCCGAGGTAGCCAGAGATTTTTACCAAACCGGGGGCGTTGCCGTCCA
GCTGCAATATAGCCCACGGGCAGTGCTCAAAAATGGCCAAATTAAAATCT
AATTGAAAATCTGCTGCTTAGTAAAAATAATAAATTCACAACATAAAACA
AAAAAAAAAAAAAAA

RE14725.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:45:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG3446-RA 1054 CG3446-RA 43..886 1..844 4205 99.8 Plus
CG3446.a 1031 CG3446.a 127..863 108..844 3685 100 Plus
CG3446.a 1031 CG3446.a 1..73 36..108 365 100 Plus
CG3446-RA 1054 CG3446-RA 935..998 837..900 320 100 Plus
CG3446.a 1031 CG3446.a 912..975 837..900 320 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:52:09
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 6241632..6242255 844..221 3120 100 Minus
chrX 22417052 chrX 6242318..6242435 225..108 575 99.2 Minus
chrX 22417052 chrX 6242489..6242596 108..1 525 99.1 Minus
chrX 22417052 chrX 6241522..6241584 899..837 315 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:36:38 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:52:07
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 6349435..6350057 844..222 3115 100 Minus
X 23542271 X 6350121..6350238 225..108 590 100 Minus
X 23542271 X 6350292..6350399 108..1 525 99.1 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:11:43
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 6357533..6358155 844..222 3115 100 Minus
X 23527363 X 6358219..6358336 225..108 590 100 Minus
X 23527363 X 6358390..6358497 108..1 525 99 Minus
X 23527363 X 6357421..6357484 900..837 320 100 Minus
Blast to na_te.dros performed on 2019-03-16 18:52:08 has no hits.

RE14725.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:53:07 Download gff for RE14725.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 6242319..6242435 108..224 99 <- Minus
chrX 6242490..6242596 1..107 99   Minus
chrX 6241522..6241579 842..899 100 <- Minus
chrX 6241635..6242251 225..841 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:56:38 Download gff for RE14725.complete
Subject Subject Range Query Range Percent Splice Strand
CG3446-RA 1..465 119..583 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:11:59 Download gff for RE14725.complete
Subject Subject Range Query Range Percent Splice Strand
CG3446-RA 1..465 119..583 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:18:12 Download gff for RE14725.complete
Subject Subject Range Query Range Percent Splice Strand
CG3446-RA 1..465 119..583 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:36:12 Download gff for RE14725.complete
Subject Subject Range Query Range Percent Splice Strand
CG3446-RA 1..465 119..583 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:52:57 Download gff for RE14725.complete
Subject Subject Range Query Range Percent Splice Strand
CG3446-RA 1..465 119..583 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:42:30 Download gff for RE14725.complete
Subject Subject Range Query Range Percent Splice Strand
CG3446-RA 1..837 1..837 99 <- Plus
CG3446-RA 894..955 838..899 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:11:59 Download gff for RE14725.complete
Subject Subject Range Query Range Percent Splice Strand
CG3446-RA 1..837 1..837 99 <- Plus
CG3446-RA 894..955 838..899 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:18:12 Download gff for RE14725.complete
Subject Subject Range Query Range Percent Splice Strand
CG3446-RA 3..839 1..837 99 <- Plus
CG3446-RA 896..957 838..899 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:36:13 Download gff for RE14725.complete
Subject Subject Range Query Range Percent Splice Strand
CG3446-RA 1..837 1..837 99 <- Plus
CG3446-RA 894..955 838..899 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:52:57 Download gff for RE14725.complete
Subject Subject Range Query Range Percent Splice Strand
CG3446-RA 3..839 1..837 99 <- Plus
CG3446-RA 896..957 838..899 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:53:07 Download gff for RE14725.complete
Subject Subject Range Query Range Percent Splice Strand
X 6349324..6349381 842..899 100 <- Minus
X 6349438..6350054 225..841 100 <- Minus
X 6350122..6350238 108..224 100 <- Minus
X 6350293..6350399 1..107 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:53:07 Download gff for RE14725.complete
Subject Subject Range Query Range Percent Splice Strand
X 6349324..6349381 842..899 100 <- Minus
X 6349438..6350054 225..841 100 <- Minus
X 6350122..6350238 108..224 100 <- Minus
X 6350293..6350399 1..107 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:53:07 Download gff for RE14725.complete
Subject Subject Range Query Range Percent Splice Strand
X 6349324..6349381 842..899 100 <- Minus
X 6349438..6350054 225..841 100 <- Minus
X 6350122..6350238 108..224 100 <- Minus
X 6350293..6350399 1..107 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:18:12 Download gff for RE14725.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 6243357..6243414 842..899 100 <- Minus
arm_X 6243471..6244087 225..841 100 <- Minus
arm_X 6244155..6244271 108..224 100 <- Minus
arm_X 6244326..6244432 1..107 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:13:36 Download gff for RE14725.complete
Subject Subject Range Query Range Percent Splice Strand
X 6357536..6358152 225..841 100 <- Minus
X 6358220..6358336 108..224 100 <- Minus
X 6358391..6358497 1..107 99   Minus
X 6357422..6357479 842..899 100 <- Minus

RE14725.hyp Sequence

Translation from 0 to 582

> RE14725.hyp
LLGILPCPKSGHTALVLCKKRHFFDNSTDFFPLFERGVTMATAVPHCPPK
QDLPPPGGYKKIPFARVPPKSYFTGFTTIGTYVVVTAVGLGIYYLTAKKV
KRDEIEMRSAQNVIFPILVAERDREFLRQLRRNRDEEAELMKNVPGWEVG
TWYGEPVFKTLPEDTLVTPIFKEFYAHSDWKSYAKRAHLKLWS*

RE14725.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:36:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG3446-PC 154 CG3446-PC 1..154 40..193 830 100 Plus
CG3446-PB 154 CG3446-PB 1..154 40..193 830 100 Plus
CG3446-PA 154 CG3446-PA 1..154 40..193 830 100 Plus

RE14725.pep Sequence

Translation from 118 to 582

> RE14725.pep
MATAVPHCPPKQDLPPPGGYKKIPFARVPPKSYFTGFTTIGTYVVVTAVG
LGIYYLTAKKVKRDEIEMRSAQNVIFPILVAERDREFLRQLRRNRDEEAE
LMKNVPGWEVGTWYGEPVFKTLPEDTLVTPIFKEFYAHSDWKSYAKRAHL
KLWS*

RE14725.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:16:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19540-PA 154 GF19540-PA 1..154 1..154 782 94.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:16:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17677-PA 154 GG17677-PA 1..154 1..154 813 99.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:16:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24919-PA 154 GH24919-PA 1..154 1..154 762 91.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:15:45
Subject Length Description Subject Range Query Range Score Percent Strand
ND-B16.6-PC 154 CG3446-PC 1..154 1..154 830 100 Plus
ND-B16.6-PB 154 CG3446-PB 1..154 1..154 830 100 Plus
ND-B16.6-PA 154 CG3446-PA 1..154 1..154 830 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:16:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15405-PA 154 GI15405-PA 1..154 1..154 791 96.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:16:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26776-PA 154 GL26776-PA 1..154 1..154 777 94.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:16:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17457-PA 154 GA17457-PA 1..154 1..154 783 94.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:16:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12577-PA 154 GM12577-PA 1..154 1..154 813 99.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:16:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24589-PA 154 GD24589-PA 1..154 1..154 813 99.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:16:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16359-PA 154 GJ16359-PA 1..154 1..154 789 94.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:16:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19996-PA 154 GK19996-PA 1..154 1..154 783 94.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:16:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16467-PA 154 GE16467-PA 1..154 1..154 815 99.4 Plus