Clone RE14873 Report

Search the DGRC for RE14873

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:148
Well:73
Vector:pFlc-1
Associated Gene/Transcriptpgc-RA
Protein status:RE14873.pep: gold
Preliminary Size:1283
Sequenced Size:698

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11296 2002-01-01 Sim4 clustering to Release 2
pgc 2008-04-29 Release 5.5 accounting
pgc 2008-08-15 Release 5.9 accounting
pgc 2008-12-18 5.12 accounting

Clone Sequence Records

RE14873.complete Sequence

698 bp (698 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071082

> RE14873.complete
AACATTTTTTTTTCTTCAAGAGAACAAGTTGAGCGTGGCTTTGAACTACA
AGAAGACCCGAAAATGTGCGACTACCAGATGGAGTACTCCTTTATTTTTG
AAGACAGCTCCTGCGAGGGCGATGCCTCGATGGCATCCTACGACAATGGA
TTCGAGTCCATGTGGCATCAAGTGCGCGAGGAGTTGCAAAGGGAGCGGGA
GATGAATGAGCTCTGCCAGGTTTTCCAGCAAAACTTGAGCCTGAGTCCGC
CGGTCATCGCGGATAGATGGAGATTCTGACTGGACCTCCCAAAAGCCAAC
TTATTGTGATATTTGTAAATTATAGTTTTAGCAGTTCGTTTGCCACATGA
GTGGAACATCGTGAATGCACTTTTGATAAGTGCTCGGTTATTTTATATTG
TAACTACCAGCCTTCAGAGGCGATCGTATGCATAGTTTCTTGAAGTCAAT
TTGTCCGTGTATTCAAATGTTTGCTTTCGTGAAAACTCGCATTGTTTTGT
CACTCTACCAAGTAATCAATTTGTACCAATCAATCGCATATGGTTGTCCT
AGATCTAAAAATGGCAATAATTTGCCTTCGGTATTGCACCTAATGTATTC
AAGAACAAGTAGGGAAGCTCGAAATTTCTCAAATACTTACCCAAAAAATA
GATAGAAATATATTTTCGATTCGCAATCGTCCAAAAAAAAAAAAAAAA

RE14873.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:50:50
Subject Length Description Subject Range Query Range Score Percent Strand
pgc-RC 741 pgc-RC 54..740 1..687 3420 99.8 Plus
pgc-RA 1173 pgc-RA 523..1172 38..687 3235 99.8 Plus
nc_8599.a 141 nc_8599.a 1..141 14..154 705 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:29:29
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 18218741..18219371 38..680 3000 98.1 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:36:47 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:29:27
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 22332171..22332820 38..687 3235 99.8 Plus
2R 25286936 2R 22330206..22330243 1..38 190 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:23:29
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 22333370..22334019 38..687 3235 99.8 Plus
2R 25260384 2R 22331405..22331442 1..38 190 100 Plus
Blast to na_te.dros performed on 2019-03-16 22:29:28 has no hits.

RE14873.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:30:23 Download gff for RE14873.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 18216771..18216807 1..38 97 -> Plus
chr2R 18218742..18219373 39..682 97   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:56:46 Download gff for RE14873.complete
Subject Subject Range Query Range Percent Splice Strand
pgc-RA 1..216 64..279 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:26:56 Download gff for RE14873.complete
Subject Subject Range Query Range Percent Splice Strand
pgc-RA 1..216 64..279 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:14:40 Download gff for RE14873.complete
Subject Subject Range Query Range Percent Splice Strand
pgc-RC 1..216 64..279 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:17:24 Download gff for RE14873.complete
Subject Subject Range Query Range Percent Splice Strand
pgc-RA 1..216 64..279 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:39:41 Download gff for RE14873.complete
Subject Subject Range Query Range Percent Splice Strand
pgc-RC 1..216 64..279 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:55:26 Download gff for RE14873.complete
Subject Subject Range Query Range Percent Splice Strand
pgc-RC 54..735 1..682 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:26:56 Download gff for RE14873.complete
Subject Subject Range Query Range Percent Splice Strand
pgc-RC 54..735 1..682 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:14:40 Download gff for RE14873.complete
Subject Subject Range Query Range Percent Splice Strand
pgc-RC 7..686 1..680 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:17:24 Download gff for RE14873.complete
Subject Subject Range Query Range Percent Splice Strand
pgc-RC 54..735 1..682 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:39:41 Download gff for RE14873.complete
Subject Subject Range Query Range Percent Splice Strand
pgc-RC 7..686 1..680 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:30:23 Download gff for RE14873.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22330206..22330243 1..38 100 -> Plus
2R 22332172..22332815 39..682 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:30:23 Download gff for RE14873.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22330206..22330243 1..38 100 -> Plus
2R 22332172..22332815 39..682 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:30:23 Download gff for RE14873.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22330206..22330243 1..38 100 -> Plus
2R 22332172..22332815 39..682 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:14:40 Download gff for RE14873.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 18217711..18217748 1..38 100 -> Plus
arm_2R 18219677..18220320 39..682 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:50:45 Download gff for RE14873.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22333371..22334014 39..682 99   Plus
2R 22331405..22331442 1..38 100 -> Plus

RE14873.hyp Sequence

Translation from 0 to 278

> RE14873.hyp
NIFFSSREQVERGFELQEDPKMCDYQMEYSFIFEDSSCEGDASMASYDNG
FESMWHQVREELQREREMNELCQVFQQNLSLSPPVIADRWRF*

RE14873.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:33:25
Subject Length Description Subject Range Query Range Score Percent Strand
pgc-PD 71 CG32885-PD 1..71 22..92 387 100 Plus
pgc-PA 71 CG32885-PA 1..71 22..92 387 100 Plus
pgc-PC 71 CG32885-PC 1..71 22..92 387 100 Plus
CG34207-PA 101 CG34207-PA 3..82 28..80 138 42.5 Plus

RE14873.pep Sequence

Translation from 63 to 278

> RE14873.pep
MCDYQMEYSFIFEDSSCEGDASMASYDNGFESMWHQVREELQREREMNEL
CQVFQQNLSLSPPVIADRWRF*

RE14873.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:24:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11882-PA 71 GF11882-PA 1..71 1..71 283 73.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:24:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22179-PA 71 GG22179-PA 1..71 1..71 371 98.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:15:57
Subject Length Description Subject Range Query Range Score Percent Strand
pgc-PD 71 CG32885-PD 1..71 1..71 387 100 Plus
pgc-PA 71 CG32885-PA 1..71 1..71 387 100 Plus
pgc-PC 71 CG32885-PC 1..71 1..71 387 100 Plus
CG34207-PA 101 CG34207-PA 3..82 7..59 138 42.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:24:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20550-PA 68 GI20550-PA 1..60 1..60 144 51.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:24:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17535-PA 71 GL17535-PA 1..71 1..71 256 69 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:24:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24195-PA 71 GA24195-PA 1..71 1..71 256 69 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:24:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15900-PA 71 GM15900-PA 1..71 1..71 373 98.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:24:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11659-PA 71 GD11659-PA 1..71 1..71 369 97.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:24:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22404-PA 70 GJ22404-PA 1..69 1..69 170 49.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:24:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20810-PA 74 GK20810-PA 1..74 1..71 212 58.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:24:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14173-PA 71 GE14173-PA 1..71 1..71 361 95.8 Plus