BDGP Sequence Production Resources |
Search the DGRC for RE14873
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 148 |
Well: | 73 |
Vector: | pFlc-1 |
Associated Gene/Transcript | pgc-RA |
Protein status: | RE14873.pep: gold |
Preliminary Size: | 1283 |
Sequenced Size: | 698 |
Gene | Date | Evidence |
---|---|---|
CG11296 | 2002-01-01 | Sim4 clustering to Release 2 |
pgc | 2008-04-29 | Release 5.5 accounting |
pgc | 2008-08-15 | Release 5.9 accounting |
pgc | 2008-12-18 | 5.12 accounting |
698 bp (698 high quality bases) assembled on 2001-12-14
GenBank Submission: AY071082
> RE14873.complete AACATTTTTTTTTCTTCAAGAGAACAAGTTGAGCGTGGCTTTGAACTACA AGAAGACCCGAAAATGTGCGACTACCAGATGGAGTACTCCTTTATTTTTG AAGACAGCTCCTGCGAGGGCGATGCCTCGATGGCATCCTACGACAATGGA TTCGAGTCCATGTGGCATCAAGTGCGCGAGGAGTTGCAAAGGGAGCGGGA GATGAATGAGCTCTGCCAGGTTTTCCAGCAAAACTTGAGCCTGAGTCCGC CGGTCATCGCGGATAGATGGAGATTCTGACTGGACCTCCCAAAAGCCAAC TTATTGTGATATTTGTAAATTATAGTTTTAGCAGTTCGTTTGCCACATGA GTGGAACATCGTGAATGCACTTTTGATAAGTGCTCGGTTATTTTATATTG TAACTACCAGCCTTCAGAGGCGATCGTATGCATAGTTTCTTGAAGTCAAT TTGTCCGTGTATTCAAATGTTTGCTTTCGTGAAAACTCGCATTGTTTTGT CACTCTACCAAGTAATCAATTTGTACCAATCAATCGCATATGGTTGTCCT AGATCTAAAAATGGCAATAATTTGCCTTCGGTATTGCACCTAATGTATTC AAGAACAAGTAGGGAAGCTCGAAATTTCTCAAATACTTACCCAAAAAATA GATAGAAATATATTTTCGATTCGCAATCGTCCAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 18218741..18219371 | 38..680 | 3000 | 98.1 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 18216771..18216807 | 1..38 | 97 | -> | Plus |
chr2R | 18218742..18219373 | 39..682 | 97 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
pgc-RA | 1..216 | 64..279 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
pgc-RA | 1..216 | 64..279 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
pgc-RC | 1..216 | 64..279 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
pgc-RA | 1..216 | 64..279 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
pgc-RC | 1..216 | 64..279 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
pgc-RC | 54..735 | 1..682 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
pgc-RC | 54..735 | 1..682 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
pgc-RC | 7..686 | 1..680 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
pgc-RC | 54..735 | 1..682 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
pgc-RC | 7..686 | 1..680 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 22330206..22330243 | 1..38 | 100 | -> | Plus |
2R | 22332172..22332815 | 39..682 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 22330206..22330243 | 1..38 | 100 | -> | Plus |
2R | 22332172..22332815 | 39..682 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 22330206..22330243 | 1..38 | 100 | -> | Plus |
2R | 22332172..22332815 | 39..682 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 18217711..18217748 | 1..38 | 100 | -> | Plus |
arm_2R | 18219677..18220320 | 39..682 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 22333371..22334014 | 39..682 | 99 | Plus | |
2R | 22331405..22331442 | 1..38 | 100 | -> | Plus |
Translation from 0 to 278
> RE14873.hyp NIFFSSREQVERGFELQEDPKMCDYQMEYSFIFEDSSCEGDASMASYDNG FESMWHQVREELQREREMNELCQVFQQNLSLSPPVIADRWRF*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
pgc-PD | 71 | CG32885-PD | 1..71 | 22..92 | 387 | 100 | Plus |
pgc-PA | 71 | CG32885-PA | 1..71 | 22..92 | 387 | 100 | Plus |
pgc-PC | 71 | CG32885-PC | 1..71 | 22..92 | 387 | 100 | Plus |
CG34207-PA | 101 | CG34207-PA | 3..82 | 28..80 | 138 | 42.5 | Plus |
Translation from 63 to 278
> RE14873.pep MCDYQMEYSFIFEDSSCEGDASMASYDNGFESMWHQVREELQREREMNEL CQVFQQNLSLSPPVIADRWRF*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF11882-PA | 71 | GF11882-PA | 1..71 | 1..71 | 283 | 73.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG22179-PA | 71 | GG22179-PA | 1..71 | 1..71 | 371 | 98.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
pgc-PD | 71 | CG32885-PD | 1..71 | 1..71 | 387 | 100 | Plus |
pgc-PA | 71 | CG32885-PA | 1..71 | 1..71 | 387 | 100 | Plus |
pgc-PC | 71 | CG32885-PC | 1..71 | 1..71 | 387 | 100 | Plus |
CG34207-PA | 101 | CG34207-PA | 3..82 | 7..59 | 138 | 42.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI20550-PA | 68 | GI20550-PA | 1..60 | 1..60 | 144 | 51.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL17535-PA | 71 | GL17535-PA | 1..71 | 1..71 | 256 | 69 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA24195-PA | 71 | GA24195-PA | 1..71 | 1..71 | 256 | 69 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM15900-PA | 71 | GM15900-PA | 1..71 | 1..71 | 373 | 98.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD11659-PA | 71 | GD11659-PA | 1..71 | 1..71 | 369 | 97.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ22404-PA | 70 | GJ22404-PA | 1..69 | 1..69 | 170 | 49.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK20810-PA | 74 | GK20810-PA | 1..74 | 1..71 | 212 | 58.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE14173-PA | 71 | GE14173-PA | 1..71 | 1..71 | 361 | 95.8 | Plus |