BDGP Sequence Production Resources |
Search the DGRC for RE14949
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 149 |
Well: | 49 |
Vector: | pFlc-1 |
Associated Gene/Transcript | Bka-RA |
Protein status: | RE14949.pep: gold |
Preliminary Size: | 672 |
Sequenced Size: | 768 |
Gene | Date | Evidence |
---|---|---|
CG4539 | 2002-01-01 | Sim4 clustering to Release 2 |
CG4539 | 2002-04-22 | Blastp of sequenced clone |
CG4539 | 2003-01-01 | Sim4 clustering to Release 3 |
Bka | 2008-04-29 | Release 5.5 accounting |
Bka | 2008-08-15 | Release 5.9 accounting |
Bka | 2008-12-18 | 5.12 accounting |
768 bp (768 high quality bases) assembled on 2002-04-22
GenBank Submission: AY113414
> RE14949.complete GAAAACAGCTGATTTTACCAAAATACTTACCACACGTGTGCCACTTTTTA AGTTATATTGTTTACAGTTTTTGGGAATTACAGCTTACAATGGGAAAACA CAAGAAAACGCAGAAGGTTAAGAAACAACGTAATGCACAGCTTAAACGCA TCATAAAACCCACAGACGCGCGGCTTAAGGATCAGATTCGAGTGAAAAGA AAGAAGGCCGAGGATCCGCACCAGATCAAGGTGCACGAGGCCACCCAGCA GAGCTCCGCTCTGTTCTTCCAGTACAACACCCAGCTGGGACCGCCGTACC ACATCGTTCTGGACACGAACTTCATTAACTTTAGCATTAAGAACAAACTG GATATTGTGCAAGGTATGATGGACTGTCTGTATGCCAAGTGCATACCCTA TATCTCCGACTGCGTGCGTGCCGAGCTGGAGAAGCTGGGCAACAAGTACA AGCTGGCCCTGCGCATCATCTCCGATCCCAGATTCGAGCGACTGCCGTGC CTGCACAAGGGCACCTATGCGGACGATTGCCTCGTGGAGCGGGTGCGCCA GCACAAATGCTACATTGTGGCCACCAACGACAAGGACCTTAAGAATCGCA TCCGGAAGATTCCCGGCGTGCCCATCATGTACGTGGCTGCGCATAAGTAC GCGATTGAGCGTATGCCAGAAGCGTATGGAGTCAAGGCGTAGACCTTTTT TACTTCTTATCCTAAGTGTACATTTTTAAATATATTCTTACATGTAAGCA GCAAAAAAAAAAAAAAAA
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 9894216..9894306 | 1..92 | 98 | -> | Plus |
chr2L | 9894367..9895026 | 93..752 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Bka-RA | 1..603 | 90..692 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Bka-RA | 1..603 | 90..692 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Bka-RA | 1..603 | 90..692 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Bka-RA | 1..603 | 90..692 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Bka-RA | 1..603 | 90..692 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Bka-RA | 3..752 | 3..752 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Bka-RA | 3..752 | 3..752 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Bka-RA | 3..754 | 1..752 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Bka-RA | 3..752 | 3..752 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Bka-RA | 3..754 | 1..752 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 9895289..9895380 | 1..92 | 97 | -> | Plus |
2L | 9895441..9896100 | 93..752 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 9895289..9895380 | 1..92 | 97 | -> | Plus |
2L | 9895441..9896100 | 93..752 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 9895289..9895380 | 1..92 | 97 | -> | Plus |
2L | 9895441..9896100 | 93..752 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 9895289..9895380 | 1..92 | 97 | -> | Plus |
arm_2L | 9895441..9896100 | 93..752 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 9895441..9896100 | 93..752 | 100 | Plus | |
2L | 9895289..9895380 | 1..92 | 97 | -> | Plus |
Translation from 2 to 691
> RE14949.hyp KQLILPKYLPHVCHFLSYIVYSFWELQLTMGKHKKTQKVKKQRNAQLKRI IKPTDARLKDQIRVKRKKAEDPHQIKVHEATQQSSALFFQYNTQLGPPYH IVLDTNFINFSIKNKLDIVQGMMDCLYAKCIPYISDCVRAELEKLGNKYK LALRIISDPRFERLPCLHKGTYADDCLVERVRQHKCYIVATNDKDLKNRI RKIPGVPIMYVAAHKYAIERMPEAYGVKA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Bka-PA | 200 | CG4539-PA | 1..200 | 30..229 | 1053 | 100 | Plus |
Translation from 89 to 691
> RE14949.pep MGKHKKTQKVKKQRNAQLKRIIKPTDARLKDQIRVKRKKAEDPHQIKVHE ATQQSSALFFQYNTQLGPPYHIVLDTNFINFSIKNKLDIVQGMMDCLYAK CIPYISDCVRAELEKLGNKYKLALRIISDPRFERLPCLHKGTYADDCLVE RVRQHKCYIVATNDKDLKNRIRKIPGVPIMYVAAHKYAIERMPEAYGVKA *
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF14675-PA | 200 | GF14675-PA | 1..200 | 1..200 | 953 | 93.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG10061-PA | 200 | GG10061-PA | 1..200 | 1..200 | 1054 | 98.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH11299-PA | 222 | GH11299-PA | 37..222 | 15..200 | 942 | 93 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Bka-PA | 200 | CG4539-PA | 1..200 | 1..200 | 1053 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI17718-PA | 200 | GI17718-PA | 1..200 | 1..200 | 949 | 92 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL18939-PA | 208 | GL18939-PA | 22..208 | 14..200 | 971 | 95.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA18243-PA | 179 | GA18243-PA | 1..179 | 22..200 | 934 | 96.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM17733-PA | 200 | GM17733-PA | 1..200 | 1..200 | 1058 | 99.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD23634-PA | 200 | GD23634-PA | 1..200 | 1..200 | 1058 | 99.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ17547-PA | 200 | GJ17547-PA | 1..200 | 1..200 | 945 | 92 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK14657-PA | 205 | GK14657-PA | 19..205 | 14..200 | 906 | 93 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE18875-PA | 200 | GE18875-PA | 1..200 | 1..200 | 1056 | 99 | Plus |