Clone RE14949 Report

Search the DGRC for RE14949

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:149
Well:49
Vector:pFlc-1
Associated Gene/TranscriptBka-RA
Protein status:RE14949.pep: gold
Preliminary Size:672
Sequenced Size:768

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4539 2002-01-01 Sim4 clustering to Release 2
CG4539 2002-04-22 Blastp of sequenced clone
CG4539 2003-01-01 Sim4 clustering to Release 3
Bka 2008-04-29 Release 5.5 accounting
Bka 2008-08-15 Release 5.9 accounting
Bka 2008-12-18 5.12 accounting

Clone Sequence Records

RE14949.complete Sequence

768 bp (768 high quality bases) assembled on 2002-04-22

GenBank Submission: AY113414

> RE14949.complete
GAAAACAGCTGATTTTACCAAAATACTTACCACACGTGTGCCACTTTTTA
AGTTATATTGTTTACAGTTTTTGGGAATTACAGCTTACAATGGGAAAACA
CAAGAAAACGCAGAAGGTTAAGAAACAACGTAATGCACAGCTTAAACGCA
TCATAAAACCCACAGACGCGCGGCTTAAGGATCAGATTCGAGTGAAAAGA
AAGAAGGCCGAGGATCCGCACCAGATCAAGGTGCACGAGGCCACCCAGCA
GAGCTCCGCTCTGTTCTTCCAGTACAACACCCAGCTGGGACCGCCGTACC
ACATCGTTCTGGACACGAACTTCATTAACTTTAGCATTAAGAACAAACTG
GATATTGTGCAAGGTATGATGGACTGTCTGTATGCCAAGTGCATACCCTA
TATCTCCGACTGCGTGCGTGCCGAGCTGGAGAAGCTGGGCAACAAGTACA
AGCTGGCCCTGCGCATCATCTCCGATCCCAGATTCGAGCGACTGCCGTGC
CTGCACAAGGGCACCTATGCGGACGATTGCCTCGTGGAGCGGGTGCGCCA
GCACAAATGCTACATTGTGGCCACCAACGACAAGGACCTTAAGAATCGCA
TCCGGAAGATTCCCGGCGTGCCCATCATGTACGTGGCTGCGCATAAGTAC
GCGATTGAGCGTATGCCAGAAGCGTATGGAGTCAAGGCGTAGACCTTTTT
TACTTCTTATCCTAAGTGTACATTTTTAAATATATTCTTACATGTAAGCA
GCAAAAAAAAAAAAAAAA

RE14949.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:55:38
Subject Length Description Subject Range Query Range Score Percent Strand
Bka-RA 957 Bka-RA 69..820 3..754 3760 100 Plus
sop-RA 1458 sop-RA 1383..1458 754..679 380 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:57:02
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 9894366..9895026 92..752 3290 99.8 Plus
chr2L 23010047 chr2L 9894217..9894307 3..93 455 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:36:50 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:57:00
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9895440..9896102 92..754 3315 100 Plus
2L 23513712 2L 9895291..9895381 3..93 455 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:14:48
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9895440..9896102 92..754 3315 100 Plus
2L 23513712 2L 9895291..9895381 3..93 455 100 Plus
Blast to na_te.dros performed on 2019-03-16 11:57:00 has no hits.

RE14949.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:57:43 Download gff for RE14949.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 9894216..9894306 1..92 98 -> Plus
chr2L 9894367..9895026 93..752 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:56:49 Download gff for RE14949.complete
Subject Subject Range Query Range Percent Splice Strand
Bka-RA 1..603 90..692 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:53:25 Download gff for RE14949.complete
Subject Subject Range Query Range Percent Splice Strand
Bka-RA 1..603 90..692 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:36:51 Download gff for RE14949.complete
Subject Subject Range Query Range Percent Splice Strand
Bka-RA 1..603 90..692 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:35:52 Download gff for RE14949.complete
Subject Subject Range Query Range Percent Splice Strand
Bka-RA 1..603 90..692 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:31:19 Download gff for RE14949.complete
Subject Subject Range Query Range Percent Splice Strand
Bka-RA 1..603 90..692 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:05:39 Download gff for RE14949.complete
Subject Subject Range Query Range Percent Splice Strand
Bka-RA 3..752 3..752 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:53:25 Download gff for RE14949.complete
Subject Subject Range Query Range Percent Splice Strand
Bka-RA 3..752 3..752 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:36:51 Download gff for RE14949.complete
Subject Subject Range Query Range Percent Splice Strand
Bka-RA 3..754 1..752 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:35:54 Download gff for RE14949.complete
Subject Subject Range Query Range Percent Splice Strand
Bka-RA 3..752 3..752 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:31:19 Download gff for RE14949.complete
Subject Subject Range Query Range Percent Splice Strand
Bka-RA 3..754 1..752 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:57:43 Download gff for RE14949.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9895289..9895380 1..92 97 -> Plus
2L 9895441..9896100 93..752 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:57:43 Download gff for RE14949.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9895289..9895380 1..92 97 -> Plus
2L 9895441..9896100 93..752 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:57:43 Download gff for RE14949.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9895289..9895380 1..92 97 -> Plus
2L 9895441..9896100 93..752 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:36:51 Download gff for RE14949.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9895289..9895380 1..92 97 -> Plus
arm_2L 9895441..9896100 93..752 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:18:24 Download gff for RE14949.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9895441..9896100 93..752 100   Plus
2L 9895289..9895380 1..92 97 -> Plus

RE14949.hyp Sequence

Translation from 2 to 691

> RE14949.hyp
KQLILPKYLPHVCHFLSYIVYSFWELQLTMGKHKKTQKVKKQRNAQLKRI
IKPTDARLKDQIRVKRKKAEDPHQIKVHEATQQSSALFFQYNTQLGPPYH
IVLDTNFINFSIKNKLDIVQGMMDCLYAKCIPYISDCVRAELEKLGNKYK
LALRIISDPRFERLPCLHKGTYADDCLVERVRQHKCYIVATNDKDLKNRI
RKIPGVPIMYVAAHKYAIERMPEAYGVKA*

RE14949.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:17:27
Subject Length Description Subject Range Query Range Score Percent Strand
Bka-PA 200 CG4539-PA 1..200 30..229 1053 100 Plus

RE14949.pep Sequence

Translation from 89 to 691

> RE14949.pep
MGKHKKTQKVKKQRNAQLKRIIKPTDARLKDQIRVKRKKAEDPHQIKVHE
ATQQSSALFFQYNTQLGPPYHIVLDTNFINFSIKNKLDIVQGMMDCLYAK
CIPYISDCVRAELEKLGNKYKLALRIISDPRFERLPCLHKGTYADDCLVE
RVRQHKCYIVATNDKDLKNRIRKIPGVPIMYVAAHKYAIERMPEAYGVKA
*

RE14949.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:52:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14675-PA 200 GF14675-PA 1..200 1..200 953 93.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:52:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10061-PA 200 GG10061-PA 1..200 1..200 1054 98.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:52:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11299-PA 222 GH11299-PA 37..222 15..200 942 93 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:47:51
Subject Length Description Subject Range Query Range Score Percent Strand
Bka-PA 200 CG4539-PA 1..200 1..200 1053 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:52:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17718-PA 200 GI17718-PA 1..200 1..200 949 92 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:52:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18939-PA 208 GL18939-PA 22..208 14..200 971 95.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:52:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18243-PA 179 GA18243-PA 1..179 22..200 934 96.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:52:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17733-PA 200 GM17733-PA 1..200 1..200 1058 99.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:52:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23634-PA 200 GD23634-PA 1..200 1..200 1058 99.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:52:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17547-PA 200 GJ17547-PA 1..200 1..200 945 92 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:52:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14657-PA 205 GK14657-PA 19..205 14..200 906 93 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:52:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18875-PA 200 GE18875-PA 1..200 1..200 1056 99 Plus