Clone RE14985 Report

Search the DGRC for RE14985

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:149
Well:85
Vector:pFlc-1
Associated Gene/TranscriptCG17737-RA
Protein status:RE14985.pep: gold
Preliminary Size:610
Sequenced Size:688

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17737 2002-01-01 Sim4 clustering to Release 2
CG17737 2002-04-04 Blastp of sequenced clone
CG17737 2003-01-01 Sim4 clustering to Release 3
CG17737 2008-04-29 Release 5.5 accounting
CG17737 2008-08-15 Release 5.9 accounting
CG17737 2008-12-18 5.12 accounting

Clone Sequence Records

RE14985.complete Sequence

688 bp (688 high quality bases) assembled on 2002-04-04

GenBank Submission: AY095068

> RE14985.complete
AGTAATCGATTTTTTTCCAGCTCTAGTCTACTTGTCAGACACATTTCCGA
AAAAAAACTCAATCAGTAAAACGTTAAATTAAAGTTTGACTATCAACAAA
TCATTTCAAAAAGTTTTTGTTTTAGGCTGTGGTTTGTTTTTATTGTCGTA
TGTCCATCCAGAATTTAAACACTCGTGACCCCTTTGCTGATGCAATCAAG
GGCAATGATGATGATATTCAAGACGGGCTAGTGCATATAAGAATCCAGCA
GAGGAACGGTCGCAAGACGCTAACCACTGTCCAGGGCCTGTCCGCGGAGT
ATGACTTGAAGAAGATAGTCCGCTCCTGCAAGAAGGAATTCGCATGCAAT
GGCACTGTAATCGAGCACCCAGAGTATGGTGAGGTTCTGCAGCTCCAGGG
CGATCAGCGTGAGAACATCTGTCAATGGTTGACGAAGGTGGGTCTAGCTA
AGCCGGATCAGCTGAAGGTGCACGGCTTCTAAGCGGTCGAACGAACAAAC
CGTGTGAATCTTCATACCACTCTTTCATTCTTAAGCTCTGCAACAACACC
CAAAAACTTGGAAAAGTTCTTTGTTCCGAATTATTCAAACTCTCTTGATA
GAACATAAACATACAGAAGCAATAGACCATTTACTGAGAACAATGTTATA
AATAAAATTAAATGTTCAATCTAAAAAAAAAAAAAAAA

RE14985.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:16:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG17737-RA 854 CG17737-RA 27..702 4..679 3350 99.7 Plus
CG17737.c 682 CG17737.c 70..635 114..679 2800 99.6 Plus
CG17737.a 674 CG17737.a 74..627 126..679 2740 99.6 Plus
CG17737.a 674 CG17737.a 5..74 4..73 350 100 Plus
CG17737.c 682 CG17737.c 8..69 4..65 310 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:21:15
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 3223716..3224052 334..670 1685 100 Plus
chr3L 24539361 chr3L 3222757..3222930 4..177 870 100 Plus
chr3L 24539361 chr3L 3223173..3223332 177..336 800 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:36:51 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:21:13
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3224312..3224657 334..679 1700 99.4 Plus
3L 28110227 3L 3223353..3223526 4..177 870 100 Plus
3L 28110227 3L 3223769..3223928 177..336 800 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:46:40
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 3224312..3224657 334..679 1700 99.4 Plus
3L 28103327 3L 3223353..3223526 4..177 870 100 Plus
3L 28103327 3L 3223769..3223928 177..336 800 100 Plus
Blast to na_te.dros performed on 2019-03-16 19:21:13 has no hits.

RE14985.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:22:07 Download gff for RE14985.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 3222754..3222930 1..177 99 -> Plus
chr3L 3223174..3223331 178..335 100 -> Plus
chr3L 3223718..3224026 336..644 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:56:52 Download gff for RE14985.complete
Subject Subject Range Query Range Percent Splice Strand
CG17737-RA 1..333 150..482 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:14:34 Download gff for RE14985.complete
Subject Subject Range Query Range Percent Splice Strand
CG17737-RA 1..333 150..482 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:37:13 Download gff for RE14985.complete
Subject Subject Range Query Range Percent Splice Strand
CG17737-RA 1..333 150..482 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:57:05 Download gff for RE14985.complete
Subject Subject Range Query Range Percent Splice Strand
CG17737-RA 1..333 150..482 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:28:07 Download gff for RE14985.complete
Subject Subject Range Query Range Percent Splice Strand
CG17737-RA 1..333 150..482 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:46:08 Download gff for RE14985.complete
Subject Subject Range Query Range Percent Splice Strand
CG17737-RA 1..671 1..672 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:14:34 Download gff for RE14985.complete
Subject Subject Range Query Range Percent Splice Strand
CG17737-RA 1..671 1..672 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:37:13 Download gff for RE14985.complete
Subject Subject Range Query Range Percent Splice Strand
CG17737-RA 10..680 1..672 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:57:05 Download gff for RE14985.complete
Subject Subject Range Query Range Percent Splice Strand
CG17737-RA 1..671 1..672 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:28:07 Download gff for RE14985.complete
Subject Subject Range Query Range Percent Splice Strand
CG17737-RA 10..680 1..672 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:22:07 Download gff for RE14985.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3223350..3223526 1..177 99 -> Plus
3L 3223770..3223927 178..335 100 -> Plus
3L 3224314..3224649 336..672 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:22:07 Download gff for RE14985.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3223350..3223526 1..177 99 -> Plus
3L 3223770..3223927 178..335 100 -> Plus
3L 3224314..3224649 336..672 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:22:07 Download gff for RE14985.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3223350..3223526 1..177 99 -> Plus
3L 3223770..3223927 178..335 100 -> Plus
3L 3224314..3224649 336..672 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:37:13 Download gff for RE14985.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3223350..3223526 1..177 99 -> Plus
arm_3L 3223770..3223927 178..335 100 -> Plus
arm_3L 3224314..3224649 336..672 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:29:33 Download gff for RE14985.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3224314..3224649 336..672 99   Plus
3L 3223350..3223526 1..177 99 -> Plus
3L 3223770..3223927 178..335 100 -> Plus

RE14985.pep Sequence

Translation from 149 to 481

> RE14985.pep
MSIQNLNTRDPFADAIKGNDDDIQDGLVHIRIQQRNGRKTLTTVQGLSAE
YDLKKIVRSCKKEFACNGTVIEHPEYGEVLQLQGDQRENICQWLTKVGLA
KPDQLKVHGF*

RE14985.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 02:33:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10123-PA 110 GF10123-PA 1..110 1..110 585 100 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 02:33:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15115-PA 110 GG15115-PA 1..110 1..110 585 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 02:33:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15775-PA 110 GH15775-PA 1..110 1..110 585 100 Plus
Dgri\GH10143-PA 110 GH10143-PA 1..110 1..110 554 93.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:37:43
Subject Length Description Subject Range Query Range Score Percent Strand
eIF1-PA 110 CG17737-PA 1..110 1..110 581 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 02:33:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12554-PA 110 GI12554-PA 1..110 1..110 585 100 Plus
Dmoj\GI22280-PA 213 GI22280-PA 104..213 1..110 577 96.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 02:33:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12102-PA 110 GL12102-PA 1..110 1..110 551 93.6 Plus
Dper\GL20331-PA 110 GL20331-PA 1..110 1..110 514 88.2 Plus
Dper\GL20332-PA 110 GL20332-PA 1..110 1..110 514 88.2 Plus
Dper\GL19547-PA 107 GL19547-PA 1..107 1..110 385 69.1 Plus
Dper\GL25504-PA 107 GL25504-PA 1..107 1..110 385 69.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 02:33:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28326-PA 110 GA28326-PA 1..110 1..110 585 100 Plus
Dpse\GA26193-PA 110 GA26193-PA 1..110 1..110 551 93.6 Plus
Dpse\GA28875-PA 110 GA28875-PA 1..110 1..110 524 90.9 Plus
Dpse\GA28869-PA 110 GA28869-PA 1..110 1..110 524 90.9 Plus
Dpse\GA22582-PA 116 GA22582-PA 9..116 7..108 334 59.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 02:33:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14550-PA 110 GM14550-PA 1..110 1..110 585 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 02:33:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13742-PA 110 GD13742-PA 1..110 1..110 585 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 02:33:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15457-PA 110 GJ15457-PA 1..110 1..110 585 100 Plus
Dvir\GJ20177-PA 110 GJ20177-PA 1..110 1..110 562 96.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 02:33:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17510-PA 110 GK17510-PA 1..110 1..110 585 100 Plus
Dwil\GK18213-PA 110 GK18213-PA 1..110 1..110 537 90 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 02:33:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21341-PA 110 GE21341-PA 1..110 1..110 585 100 Plus

RE14985.hyp Sequence

Translation from 149 to 481

> RE14985.hyp
MSIQNLNTRDPFADAIKGNDDDIQDGLVHIRIQQRNGRKTLTTVQGLSAE
YDLKKIVRSCKKEFACNGTVIEHPEYGEVLQLQGDQRENICQWLTKVGLA
KPDQLKVHGF*

RE14985.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:19:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG17737-PA 110 CG17737-PA 1..110 1..110 581 100 Plus