BDGP Sequence Production Resources |
Search the DGRC for RE14985
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 149 |
Well: | 85 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG17737-RA |
Protein status: | RE14985.pep: gold |
Preliminary Size: | 610 |
Sequenced Size: | 688 |
Gene | Date | Evidence |
---|---|---|
CG17737 | 2002-01-01 | Sim4 clustering to Release 2 |
CG17737 | 2002-04-04 | Blastp of sequenced clone |
CG17737 | 2003-01-01 | Sim4 clustering to Release 3 |
CG17737 | 2008-04-29 | Release 5.5 accounting |
CG17737 | 2008-08-15 | Release 5.9 accounting |
CG17737 | 2008-12-18 | 5.12 accounting |
688 bp (688 high quality bases) assembled on 2002-04-04
GenBank Submission: AY095068
> RE14985.complete AGTAATCGATTTTTTTCCAGCTCTAGTCTACTTGTCAGACACATTTCCGA AAAAAAACTCAATCAGTAAAACGTTAAATTAAAGTTTGACTATCAACAAA TCATTTCAAAAAGTTTTTGTTTTAGGCTGTGGTTTGTTTTTATTGTCGTA TGTCCATCCAGAATTTAAACACTCGTGACCCCTTTGCTGATGCAATCAAG GGCAATGATGATGATATTCAAGACGGGCTAGTGCATATAAGAATCCAGCA GAGGAACGGTCGCAAGACGCTAACCACTGTCCAGGGCCTGTCCGCGGAGT ATGACTTGAAGAAGATAGTCCGCTCCTGCAAGAAGGAATTCGCATGCAAT GGCACTGTAATCGAGCACCCAGAGTATGGTGAGGTTCTGCAGCTCCAGGG CGATCAGCGTGAGAACATCTGTCAATGGTTGACGAAGGTGGGTCTAGCTA AGCCGGATCAGCTGAAGGTGCACGGCTTCTAAGCGGTCGAACGAACAAAC CGTGTGAATCTTCATACCACTCTTTCATTCTTAAGCTCTGCAACAACACC CAAAAACTTGGAAAAGTTCTTTGTTCCGAATTATTCAAACTCTCTTGATA GAACATAAACATACAGAAGCAATAGACCATTTACTGAGAACAATGTTATA AATAAAATTAAATGTTCAATCTAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG17737-RA | 854 | CG17737-RA | 27..702 | 4..679 | 3350 | 99.7 | Plus |
CG17737.c | 682 | CG17737.c | 70..635 | 114..679 | 2800 | 99.6 | Plus |
CG17737.a | 674 | CG17737.a | 74..627 | 126..679 | 2740 | 99.6 | Plus |
CG17737.a | 674 | CG17737.a | 5..74 | 4..73 | 350 | 100 | Plus |
CG17737.c | 682 | CG17737.c | 8..69 | 4..65 | 310 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 3223716..3224052 | 334..670 | 1685 | 100 | Plus |
chr3L | 24539361 | chr3L | 3222757..3222930 | 4..177 | 870 | 100 | Plus |
chr3L | 24539361 | chr3L | 3223173..3223332 | 177..336 | 800 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 3222754..3222930 | 1..177 | 99 | -> | Plus |
chr3L | 3223174..3223331 | 178..335 | 100 | -> | Plus |
chr3L | 3223718..3224026 | 336..644 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17737-RA | 1..333 | 150..482 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17737-RA | 1..333 | 150..482 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17737-RA | 1..333 | 150..482 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17737-RA | 1..333 | 150..482 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17737-RA | 1..333 | 150..482 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17737-RA | 1..671 | 1..672 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17737-RA | 1..671 | 1..672 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17737-RA | 10..680 | 1..672 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17737-RA | 1..671 | 1..672 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17737-RA | 10..680 | 1..672 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 3223350..3223526 | 1..177 | 99 | -> | Plus |
3L | 3223770..3223927 | 178..335 | 100 | -> | Plus |
3L | 3224314..3224649 | 336..672 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 3223350..3223526 | 1..177 | 99 | -> | Plus |
3L | 3223770..3223927 | 178..335 | 100 | -> | Plus |
3L | 3224314..3224649 | 336..672 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 3223350..3223526 | 1..177 | 99 | -> | Plus |
3L | 3223770..3223927 | 178..335 | 100 | -> | Plus |
3L | 3224314..3224649 | 336..672 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 3223350..3223526 | 1..177 | 99 | -> | Plus |
arm_3L | 3223770..3223927 | 178..335 | 100 | -> | Plus |
arm_3L | 3224314..3224649 | 336..672 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 3224314..3224649 | 336..672 | 99 | Plus | |
3L | 3223350..3223526 | 1..177 | 99 | -> | Plus |
3L | 3223770..3223927 | 178..335 | 100 | -> | Plus |
Translation from 149 to 481
> RE14985.pep MSIQNLNTRDPFADAIKGNDDDIQDGLVHIRIQQRNGRKTLTTVQGLSAE YDLKKIVRSCKKEFACNGTVIEHPEYGEVLQLQGDQRENICQWLTKVGLA KPDQLKVHGF*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF10123-PA | 110 | GF10123-PA | 1..110 | 1..110 | 585 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG15115-PA | 110 | GG15115-PA | 1..110 | 1..110 | 585 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH15775-PA | 110 | GH15775-PA | 1..110 | 1..110 | 585 | 100 | Plus |
Dgri\GH10143-PA | 110 | GH10143-PA | 1..110 | 1..110 | 554 | 93.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
eIF1-PA | 110 | CG17737-PA | 1..110 | 1..110 | 581 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI12554-PA | 110 | GI12554-PA | 1..110 | 1..110 | 585 | 100 | Plus |
Dmoj\GI22280-PA | 213 | GI22280-PA | 104..213 | 1..110 | 577 | 96.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL12102-PA | 110 | GL12102-PA | 1..110 | 1..110 | 551 | 93.6 | Plus |
Dper\GL20331-PA | 110 | GL20331-PA | 1..110 | 1..110 | 514 | 88.2 | Plus |
Dper\GL20332-PA | 110 | GL20332-PA | 1..110 | 1..110 | 514 | 88.2 | Plus |
Dper\GL19547-PA | 107 | GL19547-PA | 1..107 | 1..110 | 385 | 69.1 | Plus |
Dper\GL25504-PA | 107 | GL25504-PA | 1..107 | 1..110 | 385 | 69.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA28326-PA | 110 | GA28326-PA | 1..110 | 1..110 | 585 | 100 | Plus |
Dpse\GA26193-PA | 110 | GA26193-PA | 1..110 | 1..110 | 551 | 93.6 | Plus |
Dpse\GA28875-PA | 110 | GA28875-PA | 1..110 | 1..110 | 524 | 90.9 | Plus |
Dpse\GA28869-PA | 110 | GA28869-PA | 1..110 | 1..110 | 524 | 90.9 | Plus |
Dpse\GA22582-PA | 116 | GA22582-PA | 9..116 | 7..108 | 334 | 59.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM14550-PA | 110 | GM14550-PA | 1..110 | 1..110 | 585 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD13742-PA | 110 | GD13742-PA | 1..110 | 1..110 | 585 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ15457-PA | 110 | GJ15457-PA | 1..110 | 1..110 | 585 | 100 | Plus |
Dvir\GJ20177-PA | 110 | GJ20177-PA | 1..110 | 1..110 | 562 | 96.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK17510-PA | 110 | GK17510-PA | 1..110 | 1..110 | 585 | 100 | Plus |
Dwil\GK18213-PA | 110 | GK18213-PA | 1..110 | 1..110 | 537 | 90 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE21341-PA | 110 | GE21341-PA | 1..110 | 1..110 | 585 | 100 | Plus |
Translation from 149 to 481
> RE14985.hyp MSIQNLNTRDPFADAIKGNDDDIQDGLVHIRIQQRNGRKTLTTVQGLSAE YDLKKIVRSCKKEFACNGTVIEHPEYGEVLQLQGDQRENICQWLTKVGLA KPDQLKVHGF*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG17737-PA | 110 | CG17737-PA | 1..110 | 1..110 | 581 | 100 | Plus |