Clone RE15191 Report

Search the DGRC for RE15191

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:151
Well:91
Vector:pFlc-1
Associated Gene/TranscriptCG15282-RA
Protein status:RE15191.pep: gold
Preliminary Size:465
Sequenced Size:399

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15282 2001-12-14 Blastp of sequenced clone
CG15282 2002-01-01 Sim4 clustering to Release 2
CG15282 2003-01-01 Sim4 clustering to Release 3
CG15282 2008-04-29 Release 5.5 accounting
CG15282 2008-08-15 Release 5.9 accounting
CG15282 2008-12-18 5.12 accounting

Clone Sequence Records

RE15191.complete Sequence

399 bp (399 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071084

> RE15191.complete
ACTGTATCGAGTGCAACATCGAAGCATCCTCATCTTCTGGGATATTAGTA
CAAATTGAATTCATTTTCAAATTCAATATGAAATTCTTGGTGATCGTTTT
TGTGGCCCTTATCGCCGTTGCTTCCGCGCTTCCTCAATTCGGATATGGAG
GATTCGGTGGATTCGGAGGATTCGGTGGCCAACAGCAGCAGCAAGAAGGA
TTCGGCGGTTTCGGAGGCTTCGGAGAACAGCAACAGCAGCAGGAAAGCTT
CGGTGGATTCGGCGGATTTGGAGGAATCGAGCAGCAGCAGCAGCAGCAAC
AAGGAGGCTTCTTCTAAGGCTGTTACTTTAGTTCCTCGACTAAAAATTAA
AATAAATTATTTGAACGTATTAGTATAACAAACAAAAAAAAAAAAAAAA

RE15191.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:57:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG15282-RA 646 CG15282-RA 71..456 4..389 1915 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:52:35
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 14711511..14711805 89..383 1475 100 Plus
chr2L 23010047 chr2L 14711355..14711442 4..91 440 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:36:56 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:52:33
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 14712824..14713124 89..389 1490 99.7 Plus
2L 23513712 2L 14712668..14712755 4..91 440 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:16:28
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 14712824..14713124 89..389 1490 99.6 Plus
2L 23513712 2L 14712668..14712755 4..91 440 100 Plus
Blast to na_te.dros performed on 2019-03-16 18:52:34 has no hits.

RE15191.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:53:22 Download gff for RE15191.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 14711352..14711440 1..89 98 -> Plus
chr2L 14711512..14711805 90..383 92   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:57:04 Download gff for RE15191.complete
Subject Subject Range Query Range Percent Splice Strand
CG15282-RA 1..240 78..317 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:56:10 Download gff for RE15191.complete
Subject Subject Range Query Range Percent Splice Strand
CG15282-RB 1..240 78..317 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:18:25 Download gff for RE15191.complete
Subject Subject Range Query Range Percent Splice Strand
CG15282-RA 1..240 78..317 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:38:45 Download gff for RE15191.complete
Subject Subject Range Query Range Percent Splice Strand
CG15282-RA 1..240 78..317 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:53:26 Download gff for RE15191.complete
Subject Subject Range Query Range Percent Splice Strand
CG15282-RA 1..240 78..317 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:09:49 Download gff for RE15191.complete
Subject Subject Range Query Range Percent Splice Strand
CG15282-RA 1..383 1..383 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:56:09 Download gff for RE15191.complete
Subject Subject Range Query Range Percent Splice Strand
CG15282-RA 1..383 1..383 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:18:25 Download gff for RE15191.complete
Subject Subject Range Query Range Percent Splice Strand
CG15282-RA 1..383 1..383 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:38:45 Download gff for RE15191.complete
Subject Subject Range Query Range Percent Splice Strand
CG15282-RA 1..383 1..383 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:53:26 Download gff for RE15191.complete
Subject Subject Range Query Range Percent Splice Strand
CG15282-RA 1..383 1..383 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:53:22 Download gff for RE15191.complete
Subject Subject Range Query Range Percent Splice Strand
2L 14712665..14712753 1..89 98 -> Plus
2L 14712825..14713118 90..383 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:53:22 Download gff for RE15191.complete
Subject Subject Range Query Range Percent Splice Strand
2L 14712665..14712753 1..89 98 -> Plus
2L 14712825..14713118 90..383 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:53:22 Download gff for RE15191.complete
Subject Subject Range Query Range Percent Splice Strand
2L 14712665..14712753 1..89 98 -> Plus
2L 14712825..14713118 90..383 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:18:25 Download gff for RE15191.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 14712665..14712753 1..89 98 -> Plus
arm_2L 14712825..14713118 90..383 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:21:50 Download gff for RE15191.complete
Subject Subject Range Query Range Percent Splice Strand
2L 14712825..14713118 90..383 100   Plus
2L 14712665..14712753 1..89 98 -> Plus

RE15191.hyp Sequence

Translation from 2 to 316

> RE15191.hyp
SIECNIEASSSSGILVQIEFIFKFNMKFLVIVFVALIAVASALPQFGYGG
FGGFGGFGGQQQQQEGFGGFGGFGEQQQQQESFGGFGGFGGIEQQQQQQQ
GGFF*

RE15191.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:41:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG15282-PB 79 CG15282-PB 1..79 26..104 420 100 Plus
CG15282-PC 79 CG15282-PC 1..79 26..104 420 100 Plus
CG15282-PA 79 CG15282-PA 1..79 26..104 420 100 Plus
CG4440-PB 79 CG4440-PB 1..74 26..103 228 66.7 Plus
CG4440-PA 79 CG4440-PA 1..74 26..103 228 66.7 Plus

RE15191.pep Sequence

Translation from 77 to 316

> RE15191.pep
MKFLVIVFVALIAVASALPQFGYGGFGGFGGFGGQQQQQEGFGGFGGFGE
QQQQQESFGGFGGFGGIEQQQQQQQGGFF*

RE15191.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:12:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG15282-PB 79 CG15282-PB 1..79 1..79 420 100 Plus
CG15282-PC 79 CG15282-PC 1..79 1..79 420 100 Plus
CG15282-PA 79 CG15282-PA 1..79 1..79 420 100 Plus
CG4440-PB 79 CG4440-PB 1..74 1..78 228 66.7 Plus
CG4440-PA 79 CG4440-PA 1..74 1..78 228 66.7 Plus
CG42586-PB 89 CG42586-PB 1..88 1..76 225 63.7 Plus
CG42586-PA 89 CG42586-PA 1..88 1..76 225 63.7 Plus
CG31775-PB 89 CG31775-PB 1..88 1..76 225 63.7 Plus
CG31775-PA 89 CG31775-PA 1..88 1..76 225 63.7 Plus
CG34165-PB 99 CG34165-PB 1..83 1..77 161 54.1 Plus
CG34165-PA 99 CG34165-PA 1..83 1..77 161 54.1 Plus
CG8157-PB 113 CG8157-PB 3..66 4..78 152 53.3 Plus
CG8157-PA 113 CG8157-PA 3..66 4..78 152 53.3 Plus
CG9877-PA 88 CG9877-PA 7..82 3..78 138 45.3 Plus