RE15191.complete Sequence
399 bp (399 high quality bases) assembled on 2001-12-14
GenBank Submission: AY071084
> RE15191.complete
ACTGTATCGAGTGCAACATCGAAGCATCCTCATCTTCTGGGATATTAGTA
CAAATTGAATTCATTTTCAAATTCAATATGAAATTCTTGGTGATCGTTTT
TGTGGCCCTTATCGCCGTTGCTTCCGCGCTTCCTCAATTCGGATATGGAG
GATTCGGTGGATTCGGAGGATTCGGTGGCCAACAGCAGCAGCAAGAAGGA
TTCGGCGGTTTCGGAGGCTTCGGAGAACAGCAACAGCAGCAGGAAAGCTT
CGGTGGATTCGGCGGATTTGGAGGAATCGAGCAGCAGCAGCAGCAGCAAC
AAGGAGGCTTCTTCTAAGGCTGTTACTTTAGTTCCTCGACTAAAAATTAA
AATAAATTATTTGAACGTATTAGTATAACAAACAAAAAAAAAAAAAAAA
RE15191.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 20:57:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15282-RA | 646 | CG15282-RA | 71..456 | 4..389 | 1915 | 99.7 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:52:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2L | 23010047 | chr2L | 14711511..14711805 | 89..383 | 1475 | 100 | Plus |
chr2L | 23010047 | chr2L | 14711355..14711442 | 4..91 | 440 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:36:56 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:52:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 14712824..14713124 | 89..389 | 1490 | 99.7 | Plus |
2L | 23513712 | 2L | 14712668..14712755 | 4..91 | 440 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:16:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 14712824..14713124 | 89..389 | 1490 | 99.6 | Plus |
2L | 23513712 | 2L | 14712668..14712755 | 4..91 | 440 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 18:52:34 has no hits.
RE15191.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:53:22 Download gff for
RE15191.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2L | 14711352..14711440 | 1..89 | 98 | -> | Plus |
chr2L | 14711512..14711805 | 90..383 | 92 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:57:04 Download gff for
RE15191.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15282-RA | 1..240 | 78..317 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:56:10 Download gff for
RE15191.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15282-RB | 1..240 | 78..317 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:18:25 Download gff for
RE15191.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15282-RA | 1..240 | 78..317 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:38:45 Download gff for
RE15191.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15282-RA | 1..240 | 78..317 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:53:26 Download gff for
RE15191.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15282-RA | 1..240 | 78..317 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:09:49 Download gff for
RE15191.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15282-RA | 1..383 | 1..383 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:56:09 Download gff for
RE15191.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15282-RA | 1..383 | 1..383 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:18:25 Download gff for
RE15191.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15282-RA | 1..383 | 1..383 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:38:45 Download gff for
RE15191.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15282-RA | 1..383 | 1..383 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:53:26 Download gff for
RE15191.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15282-RA | 1..383 | 1..383 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:53:22 Download gff for
RE15191.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 14712665..14712753 | 1..89 | 98 | -> | Plus |
2L | 14712825..14713118 | 90..383 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:53:22 Download gff for
RE15191.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 14712665..14712753 | 1..89 | 98 | -> | Plus |
2L | 14712825..14713118 | 90..383 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:53:22 Download gff for
RE15191.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 14712665..14712753 | 1..89 | 98 | -> | Plus |
2L | 14712825..14713118 | 90..383 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:18:25 Download gff for
RE15191.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 14712665..14712753 | 1..89 | 98 | -> | Plus |
arm_2L | 14712825..14713118 | 90..383 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:21:50 Download gff for
RE15191.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 14712825..14713118 | 90..383 | 100 | | Plus |
2L | 14712665..14712753 | 1..89 | 98 | -> | Plus |
RE15191.hyp Sequence
Translation from 2 to 316
> RE15191.hyp
SIECNIEASSSSGILVQIEFIFKFNMKFLVIVFVALIAVASALPQFGYGG
FGGFGGFGGQQQQQEGFGGFGGFGEQQQQQESFGGFGGFGGIEQQQQQQQ
GGFF*
RE15191.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:41:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15282-PB | 79 | CG15282-PB | 1..79 | 26..104 | 420 | 100 | Plus |
CG15282-PC | 79 | CG15282-PC | 1..79 | 26..104 | 420 | 100 | Plus |
CG15282-PA | 79 | CG15282-PA | 1..79 | 26..104 | 420 | 100 | Plus |
CG4440-PB | 79 | CG4440-PB | 1..74 | 26..103 | 228 | 66.7 | Plus |
CG4440-PA | 79 | CG4440-PA | 1..74 | 26..103 | 228 | 66.7 | Plus |
RE15191.pep Sequence
Translation from 77 to 316
> RE15191.pep
MKFLVIVFVALIAVASALPQFGYGGFGGFGGFGGQQQQQEGFGGFGGFGE
QQQQQESFGGFGGFGGIEQQQQQQQGGFF*
RE15191.pep Blast Records
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:12:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15282-PB | 79 | CG15282-PB | 1..79 | 1..79 | 420 | 100 | Plus |
CG15282-PC | 79 | CG15282-PC | 1..79 | 1..79 | 420 | 100 | Plus |
CG15282-PA | 79 | CG15282-PA | 1..79 | 1..79 | 420 | 100 | Plus |
CG4440-PB | 79 | CG4440-PB | 1..74 | 1..78 | 228 | 66.7 | Plus |
CG4440-PA | 79 | CG4440-PA | 1..74 | 1..78 | 228 | 66.7 | Plus |
CG42586-PB | 89 | CG42586-PB | 1..88 | 1..76 | 225 | 63.7 | Plus |
CG42586-PA | 89 | CG42586-PA | 1..88 | 1..76 | 225 | 63.7 | Plus |
CG31775-PB | 89 | CG31775-PB | 1..88 | 1..76 | 225 | 63.7 | Plus |
CG31775-PA | 89 | CG31775-PA | 1..88 | 1..76 | 225 | 63.7 | Plus |
CG34165-PB | 99 | CG34165-PB | 1..83 | 1..77 | 161 | 54.1 | Plus |
CG34165-PA | 99 | CG34165-PA | 1..83 | 1..77 | 161 | 54.1 | Plus |
CG8157-PB | 113 | CG8157-PB | 3..66 | 4..78 | 152 | 53.3 | Plus |
CG8157-PA | 113 | CG8157-PA | 3..66 | 4..78 | 152 | 53.3 | Plus |
CG9877-PA | 88 | CG9877-PA | 7..82 | 3..78 | 138 | 45.3 | Plus |