Clone RE15793 Report

Search the DGRC for RE15793

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:157
Well:93
Vector:pFlc-1
Associated Gene/TranscriptCG12607-RC
Protein status:RE15793.pep: gold
Sequenced Size:1007

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12607-RC 2010-01-13 Manual selection by Sue Celniker

Clone Sequence Records

RE15793.complete Sequence

1007 bp assembled on 2010-02-13

GenBank Submission: BT120347.1

> RE15793.complete
ATCTTTTGTGCTTTGAACTTCTTAAGTGTAAATTGCTCGTTTGCTTCTGC
TCGAGAAAATTTCGTGAAACCCCAAAACCAAAACAAACAAAAATGAAATT
CTTTTTGCTATTGGCTTTGGCCCTTGTGGGCATTGCTGCTGGAGCTCAGC
TTCCTGACTCCGCCACCCAGGGACCCAATCCTCAGGATATTGCCACCCCG
GAGCCGGAGTACATTGATATCGACGAACCTGCACCGGTGGCTGCCGCACC
TGCTCCTCGTCCTGTGGCCGCTGCTCCCCGTCCCGTCTTCGCCGCCCCTG
CTCCCATCGCTCGGCCAGTTGCTCATCCAGTGGCTCGCCCCGTGGTTGTG
GCCCAATCCTTCGTCCAGCAGCCCGTCCAGCAGCAGATTGTCCAGAGGGC
TCAGTACGTGGCGCCGGTGGCTCAGCAGGTGGTGTTGCCGCAACAGCAGC
TGGTGGGACACACCTACAACAGCAGGGCTGGATACCAGTACCGCCGTCCA
GTCTATGTAAGACGTTTCTATCGCCTGCGCCGCTACTAAGAGGACGCAGC
TAGATCTTAACTATATTTAATACGTGCTCGACAACCCCAGTAATTCCTCC
TATTTTGTCGTTTCTCTTCCTTCTCCTCCACTCCTCACCTGCCTGAATCA
ACTCTCTACGCACCAATCTTCAACTCAAAAACCAATCAAAATCAAAACCC
AAACCGTATCAAGCATTAACAATTATCCAAATCAACACACACATTATCAC
GCACTGATCCACACTATCAAACTGTCCAACTATCAAAATATCGTATTATA
ACTATCCTAATCCTAGAACGAAACCATCAAAGAAACGACCAACAAGAAGA
AGTCAAGATCAAAAGCATAAAGAGCGAAGTACAAAGAGACAAATGATGTT
CTAAAGACAAAGATCGAAAAACGAAGTATTCAGTTATTGTTGAATTGCCC
AGTAAAGTACGAATAAATAAACGTAAATTATTTGTAAAAATAAAAAAAAA
AAAAAAA

RE15793.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:47:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG12607.b 1162 CG12607.b 112..1112 1..1001 4945 99.6 Plus
CG12607.c 955 CG12607.c 112..617 1..506 2515 99.8 Plus
CG12607-RB 852 CG12607-RB 112..617 1..506 2515 99.8 Plus
CG12607.c 955 CG12607.c 618..905 714..1001 1395 98.9 Plus
CG12607-RB 852 CG12607-RB 614..802 813..1001 885 97.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:03:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 4446565..4447461 95..991 4470 99.9 Plus
chr3L 24539361 chr3L 4445971..4446065 1..95 460 98.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:37:25 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:03:39
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 4447176..4448082 95..1001 4490 99.7 Plus
3L 28110227 3L 4446583..4446677 1..95 460 98.9 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:45:04
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 4447176..4448082 95..1001 4490 99.6 Plus
3L 28103327 3L 4446583..4446677 1..95 460 98.9 Plus
Blast to na_te.dros performed 2019-03-16 05:03:39
Subject Length Description Subject Range Query Range Score Percent Strand
I-element 5371 I-element DMIFACA 5371bp Derived from M14954 (g157749) (Rel. 44, Last updated, Version 2). 3761..3860 711..817 121 65.1 Plus

RE15793.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:04:36 Download gff for RE15793.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 4445971..4446065 1..95 98 -> Plus
chr3L 4446566..4447461 96..991 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-02-13 14:37:40 Download gff for RE15793.complete
Subject Subject Range Query Range Percent Splice Strand
CG12607-RC 1..447 93..539 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:29:53 Download gff for RE15793.complete
Subject Subject Range Query Range Percent Splice Strand
CG12607-RC 1..447 93..539 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:14:11 Download gff for RE15793.complete
Subject Subject Range Query Range Percent Splice Strand
CG12607-RC 1..447 93..539 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:55:22 Download gff for RE15793.complete
Subject Subject Range Query Range Percent Splice Strand
CG12607-RC 1..447 93..539 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-13 14:37:38 Download gff for RE15793.complete
Subject Subject Range Query Range Percent Splice Strand
CG12607-RC 9..618 1..610 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:29:53 Download gff for RE15793.complete
Subject Subject Range Query Range Percent Splice Strand
CG12607-RC 9..618 1..610 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:14:11 Download gff for RE15793.complete
Subject Subject Range Query Range Percent Splice Strand
CG12607-RC 11..1001 1..991 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:55:22 Download gff for RE15793.complete
Subject Subject Range Query Range Percent Splice Strand
CG12607-RC 11..1001 1..991 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:04:36 Download gff for RE15793.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4446583..4446677 1..95 98 -> Plus
3L 4447177..4448072 96..991 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:04:36 Download gff for RE15793.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4446583..4446677 1..95 98 -> Plus
3L 4447177..4448072 96..991 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:04:36 Download gff for RE15793.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4446583..4446677 1..95 98 -> Plus
3L 4447177..4448072 96..991 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:14:11 Download gff for RE15793.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 4446583..4446677 1..95 98 -> Plus
arm_3L 4447177..4448072 96..991 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:15:18 Download gff for RE15793.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4447177..4448072 96..991 100   Plus
3L 4446583..4446677 1..95 98 -> Plus

RE15793.hyp Sequence

Translation from 2 to 538

> RE15793.hyp
HLCFELLKCKLLVCFCSRKFRETPKPKQTKMKFFLLLALALVGIAAGAQL
PDSATQGPNPQDIATPEPEYIDIDEPAPVAAAPAPRPVAAAPRPVFAAPA
PIARPVAHPVARPVVVAQSFVQQPVQQQIVQRAQYVAPVAQQVVLPQQQL
VGHTYNSRAGYQYRRPVYVRRFYRLRRY*

RE15793.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:22:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG12607-PC 148 CG12607-PC 1..148 31..178 757 100 Plus
CG12607-PD 139 CG12607-PD 1..138 31..168 704 100 Plus
CG12607-PB 155 CG12607-PB 1..138 31..168 704 100 Plus

RE15793.pep Sequence

Translation from 2 to 538

> RE15793.pep
LLCFELLKCKLLVCFCSRKFRETPKPKQTKMKFFLLLALALVGIAAGAQL
PDSATQGPNPQDIATPEPEYIDIDEPAPVAAAPAPRPVAAAPRPVFAAPA
PIARPVAHPVARPVVVAQSFVQQPVQQQIVQRAQYVAPVAQQVVLPQQQL
VGHTYNSRAGYQYRRPVYVRRFYRLRRY*

RE15793.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 20:24:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25074-PA 145 GF25074-PA 1..133 32..171 241 79.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 20:24:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15231-PA 154 GG15231-PA 1..137 31..168 410 87 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:55:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG12607-PC 148 CG12607-PC 1..148 31..178 757 100 Plus
CG12607-PD 139 CG12607-PD 1..138 31..168 704 100 Plus
CG12607-PB 155 CG12607-PB 1..138 31..168 704 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 20:24:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12730-PA 145 GI12730-PA 1..133 31..166 280 52.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 20:24:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11716-PA 148 GA11716-PA 1..148 31..178 359 67.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 20:24:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14662-PA 155 GM14662-PA 1..138 31..168 653 97.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 20:24:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13846-PA 164 GD13846-PA 11..149 32..170 661 97.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 20:24:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15502-PA 138 GJ15502-PA 1..138 31..178 356 62.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 20:24:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16585-PA 146 GK16585-PA 1..146 31..178 302 67.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 20:24:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21450-PA 153 GE21450-PA 1..136 31..168 315 88.6 Plus