BDGP Sequence Production Resources |
Search the DGRC for RE15793
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 157 |
Well: | 93 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG12607-RC |
Protein status: | RE15793.pep: gold |
Sequenced Size: | 1007 |
Gene | Date | Evidence |
---|---|---|
CG12607-RC | 2010-01-13 | Manual selection by Sue Celniker |
1007 bp assembled on 2010-02-13
GenBank Submission: BT120347.1
> RE15793.complete ATCTTTTGTGCTTTGAACTTCTTAAGTGTAAATTGCTCGTTTGCTTCTGC TCGAGAAAATTTCGTGAAACCCCAAAACCAAAACAAACAAAAATGAAATT CTTTTTGCTATTGGCTTTGGCCCTTGTGGGCATTGCTGCTGGAGCTCAGC TTCCTGACTCCGCCACCCAGGGACCCAATCCTCAGGATATTGCCACCCCG GAGCCGGAGTACATTGATATCGACGAACCTGCACCGGTGGCTGCCGCACC TGCTCCTCGTCCTGTGGCCGCTGCTCCCCGTCCCGTCTTCGCCGCCCCTG CTCCCATCGCTCGGCCAGTTGCTCATCCAGTGGCTCGCCCCGTGGTTGTG GCCCAATCCTTCGTCCAGCAGCCCGTCCAGCAGCAGATTGTCCAGAGGGC TCAGTACGTGGCGCCGGTGGCTCAGCAGGTGGTGTTGCCGCAACAGCAGC TGGTGGGACACACCTACAACAGCAGGGCTGGATACCAGTACCGCCGTCCA GTCTATGTAAGACGTTTCTATCGCCTGCGCCGCTACTAAGAGGACGCAGC TAGATCTTAACTATATTTAATACGTGCTCGACAACCCCAGTAATTCCTCC TATTTTGTCGTTTCTCTTCCTTCTCCTCCACTCCTCACCTGCCTGAATCA ACTCTCTACGCACCAATCTTCAACTCAAAAACCAATCAAAATCAAAACCC AAACCGTATCAAGCATTAACAATTATCCAAATCAACACACACATTATCAC GCACTGATCCACACTATCAAACTGTCCAACTATCAAAATATCGTATTATA ACTATCCTAATCCTAGAACGAAACCATCAAAGAAACGACCAACAAGAAGA AGTCAAGATCAAAAGCATAAAGAGCGAAGTACAAAGAGACAAATGATGTT CTAAAGACAAAGATCGAAAAACGAAGTATTCAGTTATTGTTGAATTGCCC AGTAAAGTACGAATAAATAAACGTAAATTATTTGTAAAAATAAAAAAAAA AAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG12607.b | 1162 | CG12607.b | 112..1112 | 1..1001 | 4945 | 99.6 | Plus |
CG12607.c | 955 | CG12607.c | 112..617 | 1..506 | 2515 | 99.8 | Plus |
CG12607-RB | 852 | CG12607-RB | 112..617 | 1..506 | 2515 | 99.8 | Plus |
CG12607.c | 955 | CG12607.c | 618..905 | 714..1001 | 1395 | 98.9 | Plus |
CG12607-RB | 852 | CG12607-RB | 614..802 | 813..1001 | 885 | 97.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
I-element | 5371 | I-element DMIFACA 5371bp Derived from M14954 (g157749) (Rel. 44, Last updated, Version 2). | 3761..3860 | 711..817 | 121 | 65.1 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 4445971..4446065 | 1..95 | 98 | -> | Plus |
chr3L | 4446566..4447461 | 96..991 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12607-RC | 1..447 | 93..539 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12607-RC | 1..447 | 93..539 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12607-RC | 1..447 | 93..539 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12607-RC | 1..447 | 93..539 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12607-RC | 9..618 | 1..610 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12607-RC | 9..618 | 1..610 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12607-RC | 11..1001 | 1..991 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12607-RC | 11..1001 | 1..991 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 4446583..4446677 | 1..95 | 98 | -> | Plus |
3L | 4447177..4448072 | 96..991 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 4446583..4446677 | 1..95 | 98 | -> | Plus |
3L | 4447177..4448072 | 96..991 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 4446583..4446677 | 1..95 | 98 | -> | Plus |
3L | 4447177..4448072 | 96..991 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 4446583..4446677 | 1..95 | 98 | -> | Plus |
arm_3L | 4447177..4448072 | 96..991 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 4447177..4448072 | 96..991 | 100 | Plus | |
3L | 4446583..4446677 | 1..95 | 98 | -> | Plus |
Translation from 2 to 538
> RE15793.hyp HLCFELLKCKLLVCFCSRKFRETPKPKQTKMKFFLLLALALVGIAAGAQL PDSATQGPNPQDIATPEPEYIDIDEPAPVAAAPAPRPVAAAPRPVFAAPA PIARPVAHPVARPVVVAQSFVQQPVQQQIVQRAQYVAPVAQQVVLPQQQL VGHTYNSRAGYQYRRPVYVRRFYRLRRY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG12607-PC | 148 | CG12607-PC | 1..148 | 31..178 | 757 | 100 | Plus |
CG12607-PD | 139 | CG12607-PD | 1..138 | 31..168 | 704 | 100 | Plus |
CG12607-PB | 155 | CG12607-PB | 1..138 | 31..168 | 704 | 100 | Plus |
Translation from 2 to 538
> RE15793.pep LLCFELLKCKLLVCFCSRKFRETPKPKQTKMKFFLLLALALVGIAAGAQL PDSATQGPNPQDIATPEPEYIDIDEPAPVAAAPAPRPVAAAPRPVFAAPA PIARPVAHPVARPVVVAQSFVQQPVQQQIVQRAQYVAPVAQQVVLPQQQL VGHTYNSRAGYQYRRPVYVRRFYRLRRY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF25074-PA | 145 | GF25074-PA | 1..133 | 32..171 | 241 | 79.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG15231-PA | 154 | GG15231-PA | 1..137 | 31..168 | 410 | 87 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG12607-PC | 148 | CG12607-PC | 1..148 | 31..178 | 757 | 100 | Plus |
CG12607-PD | 139 | CG12607-PD | 1..138 | 31..168 | 704 | 100 | Plus |
CG12607-PB | 155 | CG12607-PB | 1..138 | 31..168 | 704 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI12730-PA | 145 | GI12730-PA | 1..133 | 31..166 | 280 | 52.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA11716-PA | 148 | GA11716-PA | 1..148 | 31..178 | 359 | 67.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM14662-PA | 155 | GM14662-PA | 1..138 | 31..168 | 653 | 97.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD13846-PA | 164 | GD13846-PA | 11..149 | 32..170 | 661 | 97.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ15502-PA | 138 | GJ15502-PA | 1..138 | 31..178 | 356 | 62.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK16585-PA | 146 | GK16585-PA | 1..146 | 31..178 | 302 | 67.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE21450-PA | 153 | GE21450-PA | 1..136 | 31..168 | 315 | 88.6 | Plus |