Clone RE15880 Report

Search the DGRC for RE15880

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:158
Well:80
Vector:pFlc-1
Associated Gene/TranscriptCG14044-RA
Protein status:RE15880.pep: gold
Preliminary Size:1137
Sequenced Size:1328

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14044 2001-12-14 Blastp of sequenced clone
CG14044 2002-01-01 Sim4 clustering to Release 2
CG14044 2003-01-01 Sim4 clustering to Release 3
CG14044 2008-04-29 Release 5.5 accounting
CG14044 2008-08-15 Release 5.9 accounting
CG14044 2008-12-18 5.12 accounting

Clone Sequence Records

RE15880.complete Sequence

1328 bp (1328 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071097

> RE15880.complete
CATTCAGCGCTGGACAGGCGAACTGGAAAGGTCTAAGACGGAAGATGTCA
TCGCCGGCAGAGCGGGCGAACTTCGTGCAGCACTTCGGACAGACAACCTG
AGTGATGGGCTGTGGCTCCTCCATGGATACGCAGACGAATCCTGTCGTCA
CGGAGGTCAGCTCGGAAATGCAACCTCGCCAGAATGGCGCCTCTGGAAAT
GTGGTCGAGCAATATGTGCGCCTGGACGAGCAGATCAGCAAGCTGGAGGG
CACATGTCCTGGTCCTCGAATGGCCACCGCCGAGGCCTGGGTGGAGCACA
TTCAGAGCAAGCACGAGGCGATGCTGGGACTCGATGGCATGGGAGTGTCT
CCTTTGCGCGAGAGGGAATGGGAAACCGAGGAGGCCCTGCCCATTCCAGC
TTACACAATGGGGGGGCGGCAGGGCGACCCAATTGTGGCCAACACGCCCA
CCAAGGACCTGGCCCAGCTTGCCTACAACCTGGGCGTAATTGGCGATGCC
CGCAAGGCTTCCATGCACGAGGATTTCTTCGCCAACCTGAGCGAGTCCGC
CATGTATTTGCTTAGCATTCGTTACTACGGCGAGATGTTGGAACACACTA
AGGTGCGTCTAAAGACTCTGGCCGAGAGCTATGCAGAGCTGAACGAGCTG
TACGTAAAGCAAGACGGGATTATAGCGTATATAAGCGGGGGAACGTACAT
GACTCGGCTGGAGGAGAGCATTGATGAGCAGCTTGAGACGGCAAGAGATA
CAAGGGATAAGCTGGGCAGCGCACTGGAGCAGTGGCGCATCTGTGGATTA
CTACTTAGAGCAGCCGCGAATTCCTCGACGCAGGCATTAAAACAATGGCG
ACAGCTTGGACGGATAATAGATCCCAAGCAAAAGCTTCAGTGGGCGTTGG
ACTGTCGAAGTCTGTTACACGCCTCCACGATATCCCTAGAGGCGGCTCAG
CTGGCTCTGCCGCACGTGGAACTCAAGTACATGAGTCATCGGCAAGTCCT
AGCCGTCAAGCACTGCAACACCTACCTAATCACGGATATAGCAAACAAAG
CGCGGTACGAGCACACCAGTCGGGTCTTCACCAGTTACGAATCAAACATG
TCCAAAACCTGCACGTGGCTCTACGAAACCTTTAACAGCACGCTGCGCCC
AGACTACGACAGGGCGGAGGAAACTGTATGCGGGCTGGCCAAGACGCTCC
GGGATCATCGCGAGGAGGTCTTCAACACGGTGCGCAAGTGACATTAAACT
TATTGCTCAATTATATGGGTATTTTGTACATTACTTTAATAAACAGTAGG
CATAACATTAATAAAAAAAAAAAAAAAA

RE15880.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:47:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG14044-RA 1350 CG14044-RA 39..1348 1..1310 6550 100 Plus
mRpL24-RA 1108 mRpL24-RA 998..1108 1310..1200 555 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:21:56
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 4942446..4942848 466..868 2015 100 Plus
chr2L 23010047 chr2L 4942111..4942380 198..467 1350 100 Plus
chr2L 23010047 chr2L 4943147..4943403 1054..1310 1285 100 Plus
chr2L 23010047 chr2L 4941848..4942044 1..197 985 100 Plus
chr2L 23010047 chr2L 4942903..4943091 869..1057 945 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:37:33 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:21:54
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4943346..4943748 466..868 2015 100 Plus
2L 23513712 2L 4943011..4943280 198..467 1350 100 Plus
2L 23513712 2L 4944047..4944303 1054..1310 1285 100 Plus
2L 23513712 2L 4942748..4942944 1..197 985 100 Plus
2L 23513712 2L 4943803..4943991 869..1057 945 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:13:27
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4943346..4943748 466..868 2015 100 Plus
2L 23513712 2L 4943011..4943280 198..467 1350 100 Plus
2L 23513712 2L 4944047..4944303 1054..1310 1285 100 Plus
2L 23513712 2L 4942748..4942944 1..197 985 100 Plus
2L 23513712 2L 4943803..4943991 869..1057 945 100 Plus
Blast to na_te.dros performed on 2019-03-16 19:21:54 has no hits.

RE15880.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:22:31 Download gff for RE15880.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 4941848..4942044 1..197 100 -> Plus
chr2L 4942111..4942380 198..467 100 -> Plus
chr2L 4942448..4942848 468..868 100 -> Plus
chr2L 4942903..4943088 869..1054 100 -> Plus
chr2L 4943148..4943405 1055..1312 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:57:40 Download gff for RE15880.complete
Subject Subject Range Query Range Percent Splice Strand
CG14044-RA 1..1137 105..1241 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:14:46 Download gff for RE15880.complete
Subject Subject Range Query Range Percent Splice Strand
CG14044-RA 1..1137 105..1241 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:37:51 Download gff for RE15880.complete
Subject Subject Range Query Range Percent Splice Strand
CG14044-RA 1..1137 105..1241 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:40:01 Download gff for RE15880.complete
Subject Subject Range Query Range Percent Splice Strand
CG14044-RA 1..1137 105..1241 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:28:54 Download gff for RE15880.complete
Subject Subject Range Query Range Percent Splice Strand
CG14044-RA 1..1137 105..1241 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:46:25 Download gff for RE15880.complete
Subject Subject Range Query Range Percent Splice Strand
CG14044-RA 1..1312 1..1312 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:14:46 Download gff for RE15880.complete
Subject Subject Range Query Range Percent Splice Strand
CG14044-RA 1..1312 1..1312 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:37:51 Download gff for RE15880.complete
Subject Subject Range Query Range Percent Splice Strand
CG14044-RA 7..1318 1..1312 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:40:01 Download gff for RE15880.complete
Subject Subject Range Query Range Percent Splice Strand
CG14044-RA 1..1312 1..1312 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:28:54 Download gff for RE15880.complete
Subject Subject Range Query Range Percent Splice Strand
CG14044-RA 7..1318 1..1312 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:22:31 Download gff for RE15880.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4942748..4942944 1..197 100 -> Plus
2L 4943011..4943280 198..467 100 -> Plus
2L 4943348..4943748 468..868 100 -> Plus
2L 4943803..4943988 869..1054 100 -> Plus
2L 4944048..4944305 1055..1312 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:22:31 Download gff for RE15880.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4942748..4942944 1..197 100 -> Plus
2L 4943011..4943280 198..467 100 -> Plus
2L 4943348..4943748 468..868 100 -> Plus
2L 4943803..4943988 869..1054 100 -> Plus
2L 4944048..4944305 1055..1312 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:22:31 Download gff for RE15880.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4942748..4942944 1..197 100 -> Plus
2L 4943011..4943280 198..467 100 -> Plus
2L 4943348..4943748 468..868 100 -> Plus
2L 4943803..4943988 869..1054 100 -> Plus
2L 4944048..4944305 1055..1312 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:37:51 Download gff for RE15880.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 4942748..4942944 1..197 100 -> Plus
arm_2L 4943011..4943280 198..467 100 -> Plus
arm_2L 4943348..4943748 468..868 100 -> Plus
arm_2L 4943803..4943988 869..1054 100 -> Plus
arm_2L 4944048..4944305 1055..1312 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:16:46 Download gff for RE15880.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4943011..4943280 198..467 100 -> Plus
2L 4943348..4943748 468..868 100 -> Plus
2L 4943803..4943988 869..1054 100 -> Plus
2L 4944048..4944305 1055..1312 99   Plus
2L 4942748..4942944 1..197 100 -> Plus

RE15880.pep Sequence

Translation from 104 to 1240

> RE15880.pep
MGCGSSMDTQTNPVVTEVSSEMQPRQNGASGNVVEQYVRLDEQISKLEGT
CPGPRMATAEAWVEHIQSKHEAMLGLDGMGVSPLREREWETEEALPIPAY
TMGGRQGDPIVANTPTKDLAQLAYNLGVIGDARKASMHEDFFANLSESAM
YLLSIRYYGEMLEHTKVRLKTLAESYAELNELYVKQDGIIAYISGGTYMT
RLEESIDEQLETARDTRDKLGSALEQWRICGLLLRAAANSSTQALKQWRQ
LGRIIDPKQKLQWALDCRSLLHASTISLEAAQLALPHVELKYMSHRQVLA
VKHCNTYLITDIANKARYEHTSRVFTSYESNMSKTCTWLYETFNSTLRPD
YDRAEETVCGLAKTLRDHREEVFNTVRK*

RE15880.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:25:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23580-PA 385 GF23580-PA 1..385 1..378 1730 83.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:25:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25030-PA 377 GG25030-PA 1..377 1..378 1973 96.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:25:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13328-PA 395 GH13328-PA 1..395 1..378 1460 71.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:03:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG14044-PA 378 CG14044-PA 1..378 1..378 1962 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:25:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17802-PA 352 GI17802-PA 1..343 1..332 1327 75.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:25:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18643-PA 379 GL18643-PA 1..379 1..378 1709 83.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:25:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12723-PA 381 GA12723-PA 1..381 1..378 1714 83.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:25:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18503-PA 378 GM18503-PA 1..378 1..378 1995 97.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:25:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17627-PA 383 GJ17627-PA 1..383 1..378 1488 74 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:25:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24472-PA 373 GK24472-PA 1..373 1..378 1565 78.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:25:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11263-PA 377 GE11263-PA 1..377 1..378 1954 95.8 Plus

RE15880.hyp Sequence

Translation from 104 to 1240

> RE15880.hyp
MGCGSSMDTQTNPVVTEVSSEMQPRQNGASGNVVEQYVRLDEQISKLEGT
CPGPRMATAEAWVEHIQSKHEAMLGLDGMGVSPLREREWETEEALPIPAY
TMGGRQGDPIVANTPTKDLAQLAYNLGVIGDARKASMHEDFFANLSESAM
YLLSIRYYGEMLEHTKVRLKTLAESYAELNELYVKQDGIIAYISGGTYMT
RLEESIDEQLETARDTRDKLGSALEQWRICGLLLRAAANSSTQALKQWRQ
LGRIIDPKQKLQWALDCRSLLHASTISLEAAQLALPHVELKYMSHRQVLA
VKHCNTYLITDIANKARYEHTSRVFTSYESNMSKTCTWLYETFNSTLRPD
YDRAEETVCGLAKTLRDHREEVFNTVRK*

RE15880.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:44:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG14044-PA 378 CG14044-PA 1..378 1..378 1962 100 Plus