BDGP Sequence Production Resources |
Search the DGRC for RE15976
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 159 |
Well: | 76 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG17290-RA |
Protein status: | RE15976.pep: gold |
Preliminary Size: | 327 |
Sequenced Size: | 454 |
Gene | Date | Evidence |
---|---|---|
CG17290 | 2001-12-14 | Blastp of sequenced clone |
CG17290 | 2002-01-01 | Sim4 clustering to Release 2 |
CG17290 | 2003-01-01 | Sim4 clustering to Release 3 |
CG17290 | 2008-04-29 | Release 5.5 accounting |
CG17290 | 2008-08-15 | Release 5.9 accounting |
CG17290 | 2008-12-18 | 5.12 accounting |
454 bp (454 high quality bases) assembled on 2001-12-14
GenBank Submission: AY071098
> RE15976.complete GAGCGCACATCTTTCGTTGAGCGCAGTCTAAACACTTGAAATCATGAAAT TCCTGATCATTGCCATCGCCTTCTTGGCCTGCGCATTCGCCGATGTCTCG GAGCTTTCTGGCTACGACTACCAGCAGCCAGCTCCTGCTCCCGTGGAAAC CTACATCCCACCTGCACCGCCAGCACCTGCTCCCGTCGAGACCTACATCC CACCTGCACCACCAGCACCCGAGTACATCCCACCTGCTCCTGTCCAGGCC GAGGAACCCATCATCGAGGAGATCGAGCAGCCCGCCCAGGACGGCTACCG CTACAAGACCGTCCGCCGCCACGTCTTCCGTCACCGCAACTAAGATGAAA GCCATTTGTTATTGTTAATTTGTTGACTCGAGTGCAATTGCTGAATACCA TCTTTAGAAATTCACTTGGAGAGTAAATATCTATCTGCAAAAAAAAAAAA AAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 13042008..13042399 | 46..437 | 1900 | 99 | Plus |
chr2R | 21145070 | chr2R | 13045617..13045812 | 344..149 | 695 | 90.3 | Minus |
chr2R | 21145070 | chr2R | 13041864..13041908 | 2..46 | 195 | 95.6 | Plus |
chr2R | 21145070 | chr2R | 13045994..13046053 | 105..46 | 195 | 88.3 | Minus |
chr2R | 21145070 | chr2R | 13042089..13042141 | 169..221 | 190 | 90.6 | Plus |
chr2R | 21145070 | chr2R | 13042131..13042181 | 127..177 | 180 | 90.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 17154838..17155236 | 46..444 | 1965 | 99.5 | Plus |
2R | 25286936 | 2R | 17158444..17158639 | 344..149 | 680 | 89.8 | Minus |
2R | 25286936 | 2R | 17154700..17154744 | 2..46 | 210 | 97.8 | Plus |
2R | 25286936 | 2R | 17154919..17154969 | 169..219 | 195 | 92.2 | Plus |
2R | 25286936 | 2R | 17154961..17155011 | 127..177 | 195 | 92.2 | Plus |
2R | 25286936 | 2R | 17158822..17158880 | 104..46 | 190 | 88.1 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 17156037..17156435 | 46..444 | 1965 | 99.4 | Plus |
2R | 25260384 | 2R | 17159643..17159838 | 344..149 | 680 | 89.7 | Minus |
2R | 25260384 | 2R | 17155899..17155943 | 2..46 | 210 | 97.7 | Plus |
2R | 25260384 | 2R | 17160021..17160079 | 104..46 | 190 | 88.1 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 13041863..13041908 | 1..46 | 93 | -> | Plus |
chr2R | 13042009..13042399 | 47..438 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17290-RA | 1..300 | 44..343 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17290-RA | 1..300 | 44..343 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17290-RA | 1..300 | 44..343 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17290-RA | 1..300 | 44..343 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17290-RA | 1..300 | 44..343 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17290-RA | 2..437 | 2..438 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17290-RA | 2..437 | 2..438 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17290-RA | 3..439 | 1..438 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17290-RA | 2..437 | 2..438 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17290-RA | 3..439 | 1..438 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 17154839..17155229 | 47..438 | 99 | Plus | |
2R | 17154699..17154744 | 1..46 | 95 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 17154839..17155229 | 47..438 | 99 | Plus | |
2R | 17154699..17154744 | 1..46 | 95 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 17154839..17155229 | 47..438 | 99 | Plus | |
2R | 17154699..17154744 | 1..46 | 95 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 13042204..13042249 | 1..46 | 95 | -> | Plus |
arm_2R | 13042344..13042734 | 47..438 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 17156038..17156428 | 47..438 | 99 | Plus | |
2R | 17155898..17155943 | 1..46 | 95 | -> | Plus |
Translation from 43 to 342
> RE15976.pep MKFLIIAIAFLACAFADVSELSGYDYQQPAPAPVETYIPPAPPAPAPVET YIPPAPPAPEYIPPAPVQAEEPIIEEIEQPAQDGYRYKTVRRHVFRHRN*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF11447-PA | 101 | GF11447-PA | 4..101 | 2..99 | 422 | 95.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG20668-PA | 99 | GG20668-PA | 1..99 | 1..99 | 375 | 94.9 | Plus |
Dere\GG22209-PA | 173 | GG22209-PA | 30..173 | 1..99 | 189 | 53.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH21017-PA | 99 | GH21017-PA | 11..99 | 2..99 | 226 | 57 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG17290-PC | 99 | CG17290-PC | 1..99 | 1..99 | 532 | 100 | Plus |
CG17290-PA | 99 | CG17290-PA | 1..99 | 1..99 | 532 | 100 | Plus |
CG30458-PA | 145 | CG30458-PA | 1..145 | 1..99 | 380 | 59.3 | Plus |
CG30457-PA | 189 | CG30457-PA | 1..187 | 1..96 | 228 | 38 | Plus |
CG10953-PB | 278 | CG10953-PB | 200..277 | 29..98 | 200 | 55.1 | Plus |
CG10953-PA | 278 | CG10953-PA | 200..277 | 29..98 | 200 | 55.1 | Plus |
CG10953-PB | 278 | CG10953-PB | 1..121 | 1..80 | 182 | 41.8 | Plus |
CG10953-PA | 278 | CG10953-PA | 1..121 | 1..80 | 182 | 41.8 | Plus |
CG32248-PB | 182 | CG32248-PB | 1..181 | 1..98 | 171 | 33.5 | Plus |
CG31626-PB | 285 | CG31626-PB | 1..103 | 1..81 | 152 | 40.8 | Plus |
CG31626-PA | 285 | CG31626-PA | 1..103 | 1..81 | 152 | 40.8 | Plus |
CG11345-PA | 242 | CG11345-PA | 1..86 | 1..74 | 143 | 38.4 | Plus |
CG10953-PB | 278 | CG10953-PB | 116..173 | 28..81 | 139 | 60 | Plus |
CG10953-PA | 278 | CG10953-PA | 116..173 | 28..81 | 139 | 60 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI18611-PA | 119 | GI18611-PA | 4..119 | 2..99 | 217 | 63 | Plus |
Dmoj\GI20994-PA | 214 | GI20994-PA | 1..89 | 1..81 | 144 | 56.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL17241-PA | 102 | GL17241-PA | 1..101 | 1..98 | 400 | 91.1 | Plus |
Dper\GL17256-PA | 142 | GL17256-PA | 1..38 | 1..38 | 143 | 75 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA25057-PA | 102 | GA25057-PA | 1..101 | 1..98 | 400 | 91.1 | Plus |
Dpse\GA25055-PA | 102 | GA25055-PA | 1..101 | 1..98 | 400 | 91.1 | Plus |
Dpse\GA24150-PA | 142 | GA24150-PA | 1..38 | 1..38 | 143 | 75 | Plus |
Dpse\GA24147-PB | 142 | GA24147-PB | 1..38 | 1..38 | 143 | 75 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM21764-PA | 99 | GM21764-PA | 1..99 | 1..99 | 481 | 99 | Plus |
Dsec\GM19997-PA | 145 | GM19997-PA | 1..145 | 1..99 | 192 | 58.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD11255-PA | 99 | GD11255-PA | 1..99 | 1..99 | 481 | 99 | Plus |
Dsim\GD25488-PA | 70 | GD25488-PA | 6..70 | 35..99 | 130 | 89.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ21628-PA | 115 | GJ21628-PA | 1..115 | 1..99 | 227 | 67.8 | Plus |
Dvir\GJ20710-PA | 148 | GJ20710-PA | 1..148 | 1..99 | 212 | 50 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK17874-PA | 107 | GK17874-PA | 8..106 | 2..98 | 257 | 79 | Plus |
Dwil\GK17929-PA | 143 | GK17929-PA | 1..143 | 1..99 | 226 | 62.5 | Plus |
Dwil\GK17927-PA | 330 | GK17927-PA | 1..105 | 1..81 | 144 | 47.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE11653-PA | 101 | GE11653-PA | 1..101 | 1..99 | 465 | 96 | Plus |
Translation from 43 to 342
> RE15976.hyp MKFLIIAIAFLACAFADVSELSGYDYQQPAPAPVETYIPPAPPAPAPVET YIPPAPPAPEYIPPAPVQAEEPIIEEIEQPAQDGYRYKTVRRHVFRHRN*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG17290-PC | 99 | CG17290-PC | 1..99 | 1..99 | 532 | 100 | Plus |
CG17290-PA | 99 | CG17290-PA | 1..99 | 1..99 | 532 | 100 | Plus |
CG30458-PA | 145 | CG30458-PA | 1..145 | 1..99 | 380 | 59.3 | Plus |
CG30457-PA | 189 | CG30457-PA | 1..187 | 1..96 | 228 | 38 | Plus |
CG10953-PB | 278 | CG10953-PB | 200..277 | 29..98 | 200 | 55.1 | Plus |