Clone RE15976 Report

Search the DGRC for RE15976

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:159
Well:76
Vector:pFlc-1
Associated Gene/TranscriptCG17290-RA
Protein status:RE15976.pep: gold
Preliminary Size:327
Sequenced Size:454

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17290 2001-12-14 Blastp of sequenced clone
CG17290 2002-01-01 Sim4 clustering to Release 2
CG17290 2003-01-01 Sim4 clustering to Release 3
CG17290 2008-04-29 Release 5.5 accounting
CG17290 2008-08-15 Release 5.9 accounting
CG17290 2008-12-18 5.12 accounting

Clone Sequence Records

RE15976.complete Sequence

454 bp (454 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071098

> RE15976.complete
GAGCGCACATCTTTCGTTGAGCGCAGTCTAAACACTTGAAATCATGAAAT
TCCTGATCATTGCCATCGCCTTCTTGGCCTGCGCATTCGCCGATGTCTCG
GAGCTTTCTGGCTACGACTACCAGCAGCCAGCTCCTGCTCCCGTGGAAAC
CTACATCCCACCTGCACCGCCAGCACCTGCTCCCGTCGAGACCTACATCC
CACCTGCACCACCAGCACCCGAGTACATCCCACCTGCTCCTGTCCAGGCC
GAGGAACCCATCATCGAGGAGATCGAGCAGCCCGCCCAGGACGGCTACCG
CTACAAGACCGTCCGCCGCCACGTCTTCCGTCACCGCAACTAAGATGAAA
GCCATTTGTTATTGTTAATTTGTTGACTCGAGTGCAATTGCTGAATACCA
TCTTTAGAAATTCACTTGGAGAGTAAATATCTATCTGCAAAAAAAAAAAA
AAAA

RE15976.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:46:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG17290-RA 935 CG17290-RA 386..828 2..444 2170 99.3 Plus
CG30458-RA 789 CG30458-RA 426..621 149..344 680 89.7 Plus
CG30458-RA 789 CG30458-RA 183..243 44..104 200 88.5 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:30:51
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 13042008..13042399 46..437 1900 99 Plus
chr2R 21145070 chr2R 13045617..13045812 344..149 695 90.3 Minus
chr2R 21145070 chr2R 13041864..13041908 2..46 195 95.6 Plus
chr2R 21145070 chr2R 13045994..13046053 105..46 195 88.3 Minus
chr2R 21145070 chr2R 13042089..13042141 169..221 190 90.6 Plus
chr2R 21145070 chr2R 13042131..13042181 127..177 180 90.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:37:36 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:30:49
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17154838..17155236 46..444 1965 99.5 Plus
2R 25286936 2R 17158444..17158639 344..149 680 89.8 Minus
2R 25286936 2R 17154700..17154744 2..46 210 97.8 Plus
2R 25286936 2R 17154919..17154969 169..219 195 92.2 Plus
2R 25286936 2R 17154961..17155011 127..177 195 92.2 Plus
2R 25286936 2R 17158822..17158880 104..46 190 88.1 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:12:44
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 17156037..17156435 46..444 1965 99.4 Plus
2R 25260384 2R 17159643..17159838 344..149 680 89.7 Minus
2R 25260384 2R 17155899..17155943 2..46 210 97.7 Plus
2R 25260384 2R 17160021..17160079 104..46 190 88.1 Minus
Blast to na_te.dros performed on 2019-03-16 22:30:50 has no hits.

RE15976.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:31:57 Download gff for RE15976.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 13041863..13041908 1..46 93 -> Plus
chr2R 13042009..13042399 47..438 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:57:43 Download gff for RE15976.complete
Subject Subject Range Query Range Percent Splice Strand
CG17290-RA 1..300 44..343 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:13:39 Download gff for RE15976.complete
Subject Subject Range Query Range Percent Splice Strand
CG17290-RA 1..300 44..343 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:15:02 Download gff for RE15976.complete
Subject Subject Range Query Range Percent Splice Strand
CG17290-RA 1..300 44..343 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:38:13 Download gff for RE15976.complete
Subject Subject Range Query Range Percent Splice Strand
CG17290-RA 1..300 44..343 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:40:00 Download gff for RE15976.complete
Subject Subject Range Query Range Percent Splice Strand
CG17290-RA 1..300 44..343 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:44:57 Download gff for RE15976.complete
Subject Subject Range Query Range Percent Splice Strand
CG17290-RA 2..437 2..438 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:13:39 Download gff for RE15976.complete
Subject Subject Range Query Range Percent Splice Strand
CG17290-RA 2..437 2..438 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:15:02 Download gff for RE15976.complete
Subject Subject Range Query Range Percent Splice Strand
CG17290-RA 3..439 1..438 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:38:13 Download gff for RE15976.complete
Subject Subject Range Query Range Percent Splice Strand
CG17290-RA 2..437 2..438 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:40:00 Download gff for RE15976.complete
Subject Subject Range Query Range Percent Splice Strand
CG17290-RA 3..439 1..438 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:31:57 Download gff for RE15976.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17154839..17155229 47..438 99   Plus
2R 17154699..17154744 1..46 95 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:31:57 Download gff for RE15976.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17154839..17155229 47..438 99   Plus
2R 17154699..17154744 1..46 95 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:31:57 Download gff for RE15976.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17154839..17155229 47..438 99   Plus
2R 17154699..17154744 1..46 95 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:15:02 Download gff for RE15976.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13042204..13042249 1..46 95 -> Plus
arm_2R 13042344..13042734 47..438 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:15:29 Download gff for RE15976.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17156038..17156428 47..438 99   Plus
2R 17155898..17155943 1..46 95 -> Plus

RE15976.pep Sequence

Translation from 43 to 342

> RE15976.pep
MKFLIIAIAFLACAFADVSELSGYDYQQPAPAPVETYIPPAPPAPAPVET
YIPPAPPAPEYIPPAPVQAEEPIIEEIEQPAQDGYRYKTVRRHVFRHRN*

RE15976.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:18:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11447-PA 101 GF11447-PA 4..101 2..99 422 95.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:18:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20668-PA 99 GG20668-PA 1..99 1..99 375 94.9 Plus
Dere\GG22209-PA 173 GG22209-PA 30..173 1..99 189 53.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:18:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21017-PA 99 GH21017-PA 11..99 2..99 226 57 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:37:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG17290-PC 99 CG17290-PC 1..99 1..99 532 100 Plus
CG17290-PA 99 CG17290-PA 1..99 1..99 532 100 Plus
CG30458-PA 145 CG30458-PA 1..145 1..99 380 59.3 Plus
CG30457-PA 189 CG30457-PA 1..187 1..96 228 38 Plus
CG10953-PB 278 CG10953-PB 200..277 29..98 200 55.1 Plus
CG10953-PA 278 CG10953-PA 200..277 29..98 200 55.1 Plus
CG10953-PB 278 CG10953-PB 1..121 1..80 182 41.8 Plus
CG10953-PA 278 CG10953-PA 1..121 1..80 182 41.8 Plus
CG32248-PB 182 CG32248-PB 1..181 1..98 171 33.5 Plus
CG31626-PB 285 CG31626-PB 1..103 1..81 152 40.8 Plus
CG31626-PA 285 CG31626-PA 1..103 1..81 152 40.8 Plus
CG11345-PA 242 CG11345-PA 1..86 1..74 143 38.4 Plus
CG10953-PB 278 CG10953-PB 116..173 28..81 139 60 Plus
CG10953-PA 278 CG10953-PA 116..173 28..81 139 60 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:18:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18611-PA 119 GI18611-PA 4..119 2..99 217 63 Plus
Dmoj\GI20994-PA 214 GI20994-PA 1..89 1..81 144 56.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:18:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17241-PA 102 GL17241-PA 1..101 1..98 400 91.1 Plus
Dper\GL17256-PA 142 GL17256-PA 1..38 1..38 143 75 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:18:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25057-PA 102 GA25057-PA 1..101 1..98 400 91.1 Plus
Dpse\GA25055-PA 102 GA25055-PA 1..101 1..98 400 91.1 Plus
Dpse\GA24150-PA 142 GA24150-PA 1..38 1..38 143 75 Plus
Dpse\GA24147-PB 142 GA24147-PB 1..38 1..38 143 75 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:18:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21764-PA 99 GM21764-PA 1..99 1..99 481 99 Plus
Dsec\GM19997-PA 145 GM19997-PA 1..145 1..99 192 58.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:18:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11255-PA 99 GD11255-PA 1..99 1..99 481 99 Plus
Dsim\GD25488-PA 70 GD25488-PA 6..70 35..99 130 89.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:18:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21628-PA 115 GJ21628-PA 1..115 1..99 227 67.8 Plus
Dvir\GJ20710-PA 148 GJ20710-PA 1..148 1..99 212 50 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:18:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17874-PA 107 GK17874-PA 8..106 2..98 257 79 Plus
Dwil\GK17929-PA 143 GK17929-PA 1..143 1..99 226 62.5 Plus
Dwil\GK17927-PA 330 GK17927-PA 1..105 1..81 144 47.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:18:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11653-PA 101 GE11653-PA 1..101 1..99 465 96 Plus

RE15976.hyp Sequence

Translation from 43 to 342

> RE15976.hyp
MKFLIIAIAFLACAFADVSELSGYDYQQPAPAPVETYIPPAPPAPAPVET
YIPPAPPAPEYIPPAPVQAEEPIIEEIEQPAQDGYRYKTVRRHVFRHRN*

RE15976.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:52:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG17290-PC 99 CG17290-PC 1..99 1..99 532 100 Plus
CG17290-PA 99 CG17290-PA 1..99 1..99 532 100 Plus
CG30458-PA 145 CG30458-PA 1..145 1..99 380 59.3 Plus
CG30457-PA 189 CG30457-PA 1..187 1..96 228 38 Plus
CG10953-PB 278 CG10953-PB 200..277 29..98 200 55.1 Plus