Clone RE16005 Report

Search the DGRC for RE16005

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:160
Well:5
Vector:pFlc-1
Associated Gene/TranscriptCG14147-RA
Protein status:RE16005.pep: gold
Preliminary Size:468
Sequenced Size:776

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14147 2001-12-17 Blastp of sequenced clone
CG14147 2002-01-01 Sim4 clustering to Release 2
CG14147 2008-04-29 Release 5.5 accounting
CG14147 2008-08-15 Release 5.9 accounting
CG14147 2008-12-18 5.12 accounting

Clone Sequence Records

RE16005.complete Sequence

776 bp (776 high quality bases) assembled on 2001-12-17

GenBank Submission: AY071099

> RE16005.complete
ACAGTCAATCGACAACAGTTCAGCAGACAAAGCGTAAGCTTAGCAATTGG
ATAACCCCTCAACTTAAGCAAGGAATCTCTCAGAATGAAGTTCTTCGTGT
GCATCTTGGCTGTGCTGGCTGTGGCCCAGGCTGCCCCAGGTCTTCTGCCC
CATGTGGATAGCCATCATGGTTACCACCATGAGGAACTGCCTCATCTGCT
GGACGCTGAGATCCATCATTCGGATGGCATCCATCTGGGACACAGTGCCG
CTTTGGTGCACGATGATCACCATCTGAACCATCATTTGGATCATCATTTG
GATCACCACCTGGTTGAGTCGCTGCCAACCACAGTGTACCACCATGAGCC
ACTTCACTACCACTACGCTCGCCTGCACTCCGCTCCGGTGGTGCACCATC
ATCACCATGACACCCACGCCGCCGTGGTGCATCACAGTACCCCGGCCCAC
TTCGATGTCCACAGCCACTCGAACCTCCTGTCCTTCGCCAAGCACGCCCT
GCACGGAAAGTACGGAAAGGTCAGGATCACCGAGACCCATTATTGAGAGA
TTCCAAAAACATCCATTGTCCATAAAACCTCTGACTAGCTCCCTCATGGC
TCATAATTTATTAGGTCAATAGTTAAGCTAACGAAAAATAACTCGATTAA
ACGGGTGAGACAAGTTGAACAGATAAGCTCAGGATTTTTGTAAAAATAAA
TATTTAAGTCAATTGTTAATACAGATTTATTTTGACTAAAGTCGTTTTAA
TTTTTAAAAAAAAAAAAAAAAAAAAA

RE16005.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:36:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG14147-RA 921 CG14147-RA 75..830 1..756 3780 100 Plus
CG14147.a 722 CG14147.a 89..717 128..756 3145 100 Plus
CG14147.a 722 CG14147.a 1..90 1..90 450 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:26:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 10963741..10964407 89..755 3290 99.6 Plus
chr3L 24539361 chr3L 10963585..10963674 1..90 435 98.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:37:37 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:26:39
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 10972810..10973477 89..756 3340 100 Plus
3L 28110227 3L 10972654..10972743 1..90 450 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:04:01
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 10965910..10966577 89..756 3340 100 Plus
3L 28103327 3L 10965754..10965843 1..90 450 100 Plus
Blast to na_te.dros performed 2019-03-16 02:26:39
Subject Length Description Subject Range Query Range Score Percent Strand
Ivk 5402 Ivk IVK 5402bp 155..214 550..609 111 65 Plus
Max-element 8556 Max-element DME487856 8556bp Derived from AJ487856 (Rel. 71, Last updated, Version 1). 1012..1087 668..740 110 65.8 Plus

RE16005.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:27:20 Download gff for RE16005.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 10963585..10963674 1..90 98 -> Plus
chr3L 10963743..10964407 91..755 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:57:44 Download gff for RE16005.complete
Subject Subject Range Query Range Percent Splice Strand
CG14147-RA 1..462 85..546 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:59:30 Download gff for RE16005.complete
Subject Subject Range Query Range Percent Splice Strand
CG14147-RA 1..462 85..546 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:17:01 Download gff for RE16005.complete
Subject Subject Range Query Range Percent Splice Strand
CG14147-RA 1..462 85..546 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:24:15 Download gff for RE16005.complete
Subject Subject Range Query Range Percent Splice Strand
CG14147-RA 1..462 85..546 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:10:58 Download gff for RE16005.complete
Subject Subject Range Query Range Percent Splice Strand
CG14147-RA 1..462 85..546 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:25:07 Download gff for RE16005.complete
Subject Subject Range Query Range Percent Splice Strand
CG14147-RA 1..755 1..755 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:59:30 Download gff for RE16005.complete
Subject Subject Range Query Range Percent Splice Strand
CG14147-RA 1..755 1..755 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:17:01 Download gff for RE16005.complete
Subject Subject Range Query Range Percent Splice Strand
CG14147-RA 7..761 1..755 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:24:15 Download gff for RE16005.complete
Subject Subject Range Query Range Percent Splice Strand
CG14147-RA 1..755 1..755 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:10:58 Download gff for RE16005.complete
Subject Subject Range Query Range Percent Splice Strand
CG14147-RA 7..761 1..755 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:27:20 Download gff for RE16005.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10972654..10972743 1..90 100 -> Plus
3L 10972812..10973476 91..755 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:27:20 Download gff for RE16005.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10972654..10972743 1..90 100 -> Plus
3L 10972812..10973476 91..755 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:27:20 Download gff for RE16005.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10972654..10972743 1..90 100 -> Plus
3L 10972812..10973476 91..755 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:17:01 Download gff for RE16005.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 10965754..10965843 1..90 100 -> Plus
arm_3L 10965912..10966576 91..755 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:59:25 Download gff for RE16005.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10965912..10966576 91..755 100   Plus
3L 10965754..10965843 1..90 100 -> Plus

RE16005.pep Sequence

Translation from 84 to 545

> RE16005.pep
MKFFVCILAVLAVAQAAPGLLPHVDSHHGYHHEELPHLLDAEIHHSDGIH
LGHSAALVHDDHHLNHHLDHHLDHHLVESLPTTVYHHEPLHYHYARLHSA
PVVHHHHHDTHAAVVHHSTPAHFDVHSHSNLLSFAKHALHGKYGKVRITE
THY*

RE16005.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 03:09:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10621-PA 147 GF10621-PA 1..147 1..153 361 68.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 03:09:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15463-PA 151 GG15463-PA 1..151 1..153 688 94.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 03:09:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14924-PA 239 GH14924-PA 81..239 3..153 251 50.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:56:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG14147-PA 153 CG14147-PA 1..153 1..153 870 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 03:09:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11439-PA 189 GI11439-PA 31..189 1..153 313 56.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 03:09:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15667-PA 153 GL15667-PA 1..153 1..153 271 56.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 03:09:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12788-PA 153 GA12788-PA 1..153 1..153 271 56.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 03:09:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25236-PA 153 GM25236-PA 1..153 1..153 728 99.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 03:09:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14270-PA 153 GD14270-PA 1..153 1..153 728 99.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 03:09:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13635-PA 156 GJ13635-PA 1..156 1..153 241 52.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 03:09:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12485-PA 229 GK12485-PA 196..229 120..153 154 91.2 Plus
Dwil\GK12485-PA 229 GK12485-PA 1..102 1..91 141 40.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 03:09:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21774-PA 151 GE21774-PA 1..151 1..153 693 96.1 Plus

RE16005.hyp Sequence

Translation from 84 to 545

> RE16005.hyp
MKFFVCILAVLAVAQAAPGLLPHVDSHHGYHHEELPHLLDAEIHHSDGIH
LGHSAALVHDDHHLNHHLDHHLDHHLVESLPTTVYHHEPLHYHYARLHSA
PVVHHHHHDTHAAVVHHSTPAHFDVHSHSNLLSFAKHALHGKYGKVRITE
THY*

RE16005.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:22:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG14147-PA 153 CG14147-PA 1..153 1..153 870 100 Plus