RE16123.complete Sequence
399 bp (399 high quality bases) assembled on 2001-12-14
GenBank Submission: AY071100
> RE16123.complete
CAGTTGCAGTTTTATCCTCAAAGACGATTCATCATATACTCTTACTCCAG
TATCGCTAAAGAAGCTAAAAGTGTTTTCAAAATGAAATTCTTGATTTTCT
GTCTGATTGCTCTGTTTGCCATAGCCTCGGCGCGTCCCCAGTTCGGATTC
GGCGGATTTGGTGGCGGGCTTGAGCAGCAGCAACAGCAGGGCGGTTTTGG
ACAAGGATTCGGTGGTTTCGGTTCCTTTGGACAGCAGCAACAGCAGGAAA
GTTTTGGCGGAAATGGAAACTTTGGTCAGCAGCAACAAGAGTTTGGTGGT
TTCGGCGGTTTTTACGGTTAAATACTAATGAACTGATAATTTGTCTTATA
TGTAAATTTATTAAAAAACTAAATGGAAATCTGAAAAAAAAAAAAAAAA
RE16123.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 19:43:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG4440-RA | 618 | CG4440-RA | 51..432 | 1..382 | 1910 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:27:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2L | 23010047 | chr2L | 16328941..16329230 | 93..382 | 1450 | 100 | Plus |
chr2L | 23010047 | chr2L | 16328790..16328882 | 1..93 | 465 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:37:39 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:27:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 16330078..16330367 | 93..382 | 1450 | 100 | Plus |
2L | 23513712 | 2L | 16329927..16330019 | 1..93 | 465 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:10:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 16330078..16330367 | 93..382 | 1450 | 100 | Plus |
2L | 23513712 | 2L | 16329927..16330019 | 1..93 | 465 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 12:27:36 has no hits.
RE16123.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:28:24 Download gff for
RE16123.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2L | 16328790..16328882 | 1..93 | 100 | -> | Plus |
chr2L | 16328942..16329230 | 94..383 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:57:46 Download gff for
RE16123.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG4440-RA | 1..240 | 82..321 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:09:28 Download gff for
RE16123.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG4440-RA | 1..240 | 82..321 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 14:54:42 Download gff for
RE16123.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG4440-RA | 1..240 | 82..321 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:33:42 Download gff for
RE16123.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG4440-RA | 1..240 | 82..321 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:46:13 Download gff for
RE16123.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG4440-RA | 1..240 | 82..321 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:39:02 Download gff for
RE16123.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG4440-RA | 1..382 | 1..383 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:09:28 Download gff for
RE16123.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG4440-RA | 1..382 | 1..383 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 14:54:42 Download gff for
RE16123.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG4440-RA | 3..384 | 1..382 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:33:42 Download gff for
RE16123.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG4440-RA | 1..382 | 1..383 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:46:13 Download gff for
RE16123.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG4440-RA | 3..384 | 1..382 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:28:24 Download gff for
RE16123.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 16329927..16330019 | 1..93 | 100 | -> | Plus |
2L | 16330079..16330367 | 94..383 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:28:24 Download gff for
RE16123.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 16329927..16330019 | 1..93 | 100 | -> | Plus |
2L | 16330079..16330367 | 94..383 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:28:24 Download gff for
RE16123.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 16329927..16330019 | 1..93 | 100 | -> | Plus |
2L | 16330079..16330367 | 94..383 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 14:54:42 Download gff for
RE16123.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 16329927..16330019 | 1..93 | 100 | -> | Plus |
arm_2L | 16330079..16330367 | 94..383 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:10:47 Download gff for
RE16123.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 16330079..16330367 | 94..383 | 99 | | Plus |
2L | 16329927..16330019 | 1..93 | 100 | -> | Plus |
RE16123.hyp Sequence
Translation from 0 to 320
> RE16123.hyp
QLQFYPQRRFIIYSYSSIAKEAKSVFKMKFLIFCLIALFAIASARPQFGF
GGFGGGLEQQQQQGGFGQGFGGFGSFGQQQQQESFGGNGNFGQQQQEFGG
FGGFYG*
RE16123.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:31:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG4440-PB | 79 | CG4440-PB | 1..79 | 28..106 | 429 | 100 | Plus |
CG4440-PA | 79 | CG4440-PA | 1..79 | 28..106 | 429 | 100 | Plus |
CG15282-PB | 79 | CG15282-PB | 1..78 | 28..101 | 228 | 66.7 | Plus |
CG15282-PC | 79 | CG15282-PC | 1..78 | 28..101 | 228 | 66.7 | Plus |
CG15282-PA | 79 | CG15282-PA | 1..78 | 28..101 | 228 | 66.7 | Plus |
RE16123.pep Sequence
Translation from 81 to 320
> RE16123.pep
MKFLIFCLIALFAIASARPQFGFGGFGGGLEQQQQQGGFGQGFGGFGSFG
QQQQQESFGGNGNFGQQQQEFGGFGGFYG*
RE16123.pep Blast Records
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:26:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG4440-PB | 79 | CG4440-PB | 1..79 | 1..79 | 429 | 100 | Plus |
CG4440-PA | 79 | CG4440-PA | 1..79 | 1..79 | 429 | 100 | Plus |
CG15282-PB | 79 | CG15282-PB | 1..78 | 1..74 | 228 | 66.7 | Plus |
CG15282-PC | 79 | CG15282-PC | 1..78 | 1..74 | 228 | 66.7 | Plus |
CG15282-PA | 79 | CG15282-PA | 1..78 | 1..74 | 228 | 66.7 | Plus |
CG42586-PB | 89 | CG42586-PB | 1..75 | 1..79 | 214 | 65.9 | Plus |
CG42586-PA | 89 | CG42586-PA | 1..75 | 1..79 | 214 | 65.9 | Plus |
CG31775-PB | 89 | CG31775-PB | 1..75 | 1..79 | 214 | 65.9 | Plus |
CG31775-PA | 89 | CG31775-PA | 1..75 | 1..79 | 214 | 65.9 | Plus |
CG8157-PB | 113 | CG8157-PB | 3..81 | 4..79 | 141 | 48.1 | Plus |
CG8157-PA | 113 | CG8157-PA | 3..81 | 4..79 | 141 | 48.1 | Plus |
CG9877-PA | 88 | CG9877-PA | 1..88 | 1..79 | 133 | 38.5 | Plus |
CG34165-PB | 99 | CG34165-PB | 1..99 | 1..76 | 131 | 42.6 | Plus |
CG34165-PA | 99 | CG34165-PA | 1..99 | 1..76 | 131 | 42.6 | Plus |