Clone RE16123 Report

Search the DGRC for RE16123

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:161
Well:23
Vector:pFlc-1
Associated Gene/TranscriptCG4440-RA
Protein status:RE16123.pep: gold
Preliminary Size:364
Sequenced Size:399

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4440 2001-12-14 Blastp of sequenced clone
CG4440 2002-01-01 Sim4 clustering to Release 2
CG4440 2003-01-01 Sim4 clustering to Release 3
CG4440 2008-04-29 Release 5.5 accounting
CG4440 2008-08-15 Release 5.9 accounting
CG4440 2008-12-18 5.12 accounting

Clone Sequence Records

RE16123.complete Sequence

399 bp (399 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071100

> RE16123.complete
CAGTTGCAGTTTTATCCTCAAAGACGATTCATCATATACTCTTACTCCAG
TATCGCTAAAGAAGCTAAAAGTGTTTTCAAAATGAAATTCTTGATTTTCT
GTCTGATTGCTCTGTTTGCCATAGCCTCGGCGCGTCCCCAGTTCGGATTC
GGCGGATTTGGTGGCGGGCTTGAGCAGCAGCAACAGCAGGGCGGTTTTGG
ACAAGGATTCGGTGGTTTCGGTTCCTTTGGACAGCAGCAACAGCAGGAAA
GTTTTGGCGGAAATGGAAACTTTGGTCAGCAGCAACAAGAGTTTGGTGGT
TTCGGCGGTTTTTACGGTTAAATACTAATGAACTGATAATTTGTCTTATA
TGTAAATTTATTAAAAAACTAAATGGAAATCTGAAAAAAAAAAAAAAAA

RE16123.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:43:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG4440-RA 618 CG4440-RA 51..432 1..382 1910 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:27:38
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 16328941..16329230 93..382 1450 100 Plus
chr2L 23010047 chr2L 16328790..16328882 1..93 465 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:37:39 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:27:36
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16330078..16330367 93..382 1450 100 Plus
2L 23513712 2L 16329927..16330019 1..93 465 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:10:11
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16330078..16330367 93..382 1450 100 Plus
2L 23513712 2L 16329927..16330019 1..93 465 100 Plus
Blast to na_te.dros performed on 2019-03-16 12:27:36 has no hits.

RE16123.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:28:24 Download gff for RE16123.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 16328790..16328882 1..93 100 -> Plus
chr2L 16328942..16329230 94..383 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:57:46 Download gff for RE16123.complete
Subject Subject Range Query Range Percent Splice Strand
CG4440-RA 1..240 82..321 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:09:28 Download gff for RE16123.complete
Subject Subject Range Query Range Percent Splice Strand
CG4440-RA 1..240 82..321 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 14:54:42 Download gff for RE16123.complete
Subject Subject Range Query Range Percent Splice Strand
CG4440-RA 1..240 82..321 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:33:42 Download gff for RE16123.complete
Subject Subject Range Query Range Percent Splice Strand
CG4440-RA 1..240 82..321 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:46:13 Download gff for RE16123.complete
Subject Subject Range Query Range Percent Splice Strand
CG4440-RA 1..240 82..321 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:39:02 Download gff for RE16123.complete
Subject Subject Range Query Range Percent Splice Strand
CG4440-RA 1..382 1..383 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:09:28 Download gff for RE16123.complete
Subject Subject Range Query Range Percent Splice Strand
CG4440-RA 1..382 1..383 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 14:54:42 Download gff for RE16123.complete
Subject Subject Range Query Range Percent Splice Strand
CG4440-RA 3..384 1..382 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:33:42 Download gff for RE16123.complete
Subject Subject Range Query Range Percent Splice Strand
CG4440-RA 1..382 1..383 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:46:13 Download gff for RE16123.complete
Subject Subject Range Query Range Percent Splice Strand
CG4440-RA 3..384 1..382 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:28:24 Download gff for RE16123.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16329927..16330019 1..93 100 -> Plus
2L 16330079..16330367 94..383 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:28:24 Download gff for RE16123.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16329927..16330019 1..93 100 -> Plus
2L 16330079..16330367 94..383 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:28:24 Download gff for RE16123.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16329927..16330019 1..93 100 -> Plus
2L 16330079..16330367 94..383 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 14:54:42 Download gff for RE16123.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 16329927..16330019 1..93 100 -> Plus
arm_2L 16330079..16330367 94..383 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:10:47 Download gff for RE16123.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16330079..16330367 94..383 99   Plus
2L 16329927..16330019 1..93 100 -> Plus

RE16123.hyp Sequence

Translation from 0 to 320

> RE16123.hyp
QLQFYPQRRFIIYSYSSIAKEAKSVFKMKFLIFCLIALFAIASARPQFGF
GGFGGGLEQQQQQGGFGQGFGGFGSFGQQQQQESFGGNGNFGQQQQEFGG
FGGFYG*

RE16123.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:31:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG4440-PB 79 CG4440-PB 1..79 28..106 429 100 Plus
CG4440-PA 79 CG4440-PA 1..79 28..106 429 100 Plus
CG15282-PB 79 CG15282-PB 1..78 28..101 228 66.7 Plus
CG15282-PC 79 CG15282-PC 1..78 28..101 228 66.7 Plus
CG15282-PA 79 CG15282-PA 1..78 28..101 228 66.7 Plus

RE16123.pep Sequence

Translation from 81 to 320

> RE16123.pep
MKFLIFCLIALFAIASARPQFGFGGFGGGLEQQQQQGGFGQGFGGFGSFG
QQQQQESFGGNGNFGQQQQEFGGFGGFYG*

RE16123.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:26:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG4440-PB 79 CG4440-PB 1..79 1..79 429 100 Plus
CG4440-PA 79 CG4440-PA 1..79 1..79 429 100 Plus
CG15282-PB 79 CG15282-PB 1..78 1..74 228 66.7 Plus
CG15282-PC 79 CG15282-PC 1..78 1..74 228 66.7 Plus
CG15282-PA 79 CG15282-PA 1..78 1..74 228 66.7 Plus
CG42586-PB 89 CG42586-PB 1..75 1..79 214 65.9 Plus
CG42586-PA 89 CG42586-PA 1..75 1..79 214 65.9 Plus
CG31775-PB 89 CG31775-PB 1..75 1..79 214 65.9 Plus
CG31775-PA 89 CG31775-PA 1..75 1..79 214 65.9 Plus
CG8157-PB 113 CG8157-PB 3..81 4..79 141 48.1 Plus
CG8157-PA 113 CG8157-PA 3..81 4..79 141 48.1 Plus
CG9877-PA 88 CG9877-PA 1..88 1..79 133 38.5 Plus
CG34165-PB 99 CG34165-PB 1..99 1..76 131 42.6 Plus
CG34165-PA 99 CG34165-PA 1..99 1..76 131 42.6 Plus