Clone RE16138 Report

Search the DGRC for RE16138

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:161
Well:38
Vector:pFlc-1
Associated Gene/TranscriptmRpL53-RA
Protein status:RE16138.pep: gold
Sequenced Size:841

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
mRpL53 2009-01-14 Manual selection by Sue Celniker

Clone Sequence Records

RE16138.complete Sequence

841 bp assembled on 2009-03-10

GenBank Submission: BT072874.1

> RE16138.complete
GCTATCGTCGCTCAGCTGTTACGTAGCGTGTTTGTTACGTCGTAAATTTT
GTGCGGAAAAACCGCAGAGTTTTCATTGCCGCCGTGAAAAAAACATAAAT
AATGTCTGTGCCTTTCAGTGGCGCATTGCGGCGTTCCGGCGGCATTGTGT
CCGCCATTGGCAAGCAGCTGAAGAGCGTGAATTTGAAGGGCGTCAAGCGG
ATAACCGTGCAGTTCGATCCATTCGCGGAAAATGTCAAGTCCACACGGGA
ATTCCTCTTCCTGCTCTCCACACCCAAAGTGGCAGCTACGAATCCCAAGT
GCGTGGTCAAGCCAGAAATCGTCTGCGATCGCCAGCCGGCCAACATCAAG
TTTGCCCTGATTGATTCAGCGCAAGAACAAGCCCAAGTCAAGGAGATCCG
CTTCAACAGCGATAACCTAAACACACTAGAGCTGCTGCAGCTGTGCAACA
AGCACGTGTCCAGCTTGGCACCGCGCGAGGAGATCACCAACAAGGTCCTG
ACCAAGGCGGAGAAACAGAAACTAGCAGGAGGCGCCGGCGGCGGAAAGAA
GGCAACCAAGAAGAAGTAACCATCAGGATGGTGAGGAAGCACAAAGGAAC
ACTGGCGGTGATCGAGAAGATCTACCAGGATATACCCGCATTCTCCGACA
TCTTCACCGAGGAGAGCTTCTACATGTTCGCCTTCTGTTTCGTGTGCGCC
ACCATTCTGGTGGCCTTCATTCTCTCCCGGTTCATCACCATCAAGCCCGT
CGATTTCTAAGCCAATTGTATTGTTCAATTCCGCACACGTACTTTTCAAA
ATATATATACGCTCTAACATGTAACAAAAAAAAAAAAAAAA

RE16138.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:26:14
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL53-RA 830 mRpL53-RA 1..828 1..828 4140 100 Plus
CG33155-RC 830 CG33155-RC 1..828 1..828 4140 100 Plus
CG33155-RA 730 CG33155-RA 147..728 247..828 2910 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:34:22
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 9842548..9842999 374..825 2260 100 Plus
chr2R 21145070 chr2R 9841534..9841781 1..248 1240 100 Plus
chr2R 21145070 chr2R 9842251..9842379 247..375 645 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:37:41 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:34:20
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 13955213..13955667 374..828 2275 100 Plus
2R 25286936 2R 13954199..13954446 1..248 1240 100 Plus
2R 25286936 2R 13954916..13955044 247..375 645 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:43:09
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 13956412..13956866 374..828 2275 100 Plus
2R 25260384 2R 13955398..13955645 1..248 1240 100 Plus
2R 25260384 2R 13956115..13956243 247..375 645 100 Plus
Blast to na_te.dros performed on 2019-03-16 07:34:21 has no hits.

RE16138.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:35:05 Download gff for RE16138.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 9841534..9841780 1..247 100 -> Plus
chr2R 9842252..9842379 248..375 100 -> Plus
chr2R 9842550..9842999 376..825 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:52:11 Download gff for RE16138.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL53-RA 1..468 102..569 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:39:27 Download gff for RE16138.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL53-RA 1..468 102..569 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:23:55 Download gff for RE16138.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL53-RA 1..468 102..569 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:36:25 Download gff for RE16138.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL53-RA 1..468 102..569 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-03-10 12:45:24 Download gff for RE16138.complete
Subject Subject Range Query Range Percent Splice Strand
CG33155-RC 1..825 1..825 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:39:27 Download gff for RE16138.complete
Subject Subject Range Query Range Percent Splice Strand
CG33155-RC 1..825 1..825 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:23:55 Download gff for RE16138.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL53-RA 5..829 1..825 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:36:25 Download gff for RE16138.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL53-RA 5..829 1..825 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:35:05 Download gff for RE16138.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13954917..13955044 248..375 100 -> Plus
2R 13954199..13954445 1..247 100 -> Plus
2R 13955215..13955664 376..825 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:35:05 Download gff for RE16138.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13954917..13955044 248..375 100 -> Plus
2R 13954199..13954445 1..247 100 -> Plus
2R 13955215..13955664 376..825 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:35:05 Download gff for RE16138.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13954917..13955044 248..375 100 -> Plus
2R 13954199..13954445 1..247 100 -> Plus
2R 13955215..13955664 376..825 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:23:55 Download gff for RE16138.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 9841704..9841950 1..247 100 -> Plus
arm_2R 9842422..9842549 248..375 100 -> Plus
arm_2R 9842720..9843169 376..825 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:13:30 Download gff for RE16138.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13955398..13955644 1..247 100 -> Plus
2R 13956116..13956243 248..375 100 -> Plus
2R 13956414..13956863 376..825 100   Plus

RE16138.pep Sequence

Translation from 101 to 568

> RE16138.pep
MSVPFSGALRRSGGIVSAIGKQLKSVNLKGVKRITVQFDPFAENVKSTRE
FLFLLSTPKVAATNPKCVVKPEIVCDRQPANIKFALIDSAQEQAQVKEIR
FNSDNLNTLELLQLCNKHVSSLAPREEITNKVLTKAEKQKLAGGAGGGKK
ATKKK*

RE16138.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:13:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13720-PA 155 GF13720-PA 1..139 1..139 667 92.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:13:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20412-PA 155 GG20412-PA 1..155 1..155 783 98.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:13:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22824-PA 156 GH22824-PA 1..141 1..141 605 90.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:49:09
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL53-PA 155 CG30481-PA 1..155 1..155 773 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:13:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21202-PA 154 GI21202-PA 1..143 1..143 582 86.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:13:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17398-PA 152 GL17398-PA 1..152 1..155 620 86.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:13:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17351-PA 152 GA17351-PA 1..152 1..155 623 87.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:14:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23256-PA 155 GM23256-PA 1..155 1..155 771 96.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:14:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10993-PA 155 GD10993-PA 1..155 1..155 773 96.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:14:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20803-PA 152 GJ20803-PA 1..137 1..137 641 89.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:14:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17949-PA 155 GK17949-PA 1..139 1..139 656 89.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:14:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12572-PA 155 GE12572-PA 1..155 1..155 791 98.7 Plus

RE16138.hyp Sequence

Translation from 101 to 568

> RE16138.hyp
MSVPFSGALRRSGGIVSAIGKQLKSVNLKGVKRITVQFDPFAENVKSTRE
FLFLLSTPKVAATNPKCVVKPEIVCDRQPANIKFALIDSAQEQAQVKEIR
FNSDNLNTLELLQLCNKHVSSLAPREEITNKVLTKAEKQKLAGGAGGGKK
ATKKK*

RE16138.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:18:40
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL53-PA 155 CG30481-PA 1..155 1..155 773 100 Plus