BDGP Sequence Production Resources |
Search the DGRC for RE16138
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 161 |
Well: | 38 |
Vector: | pFlc-1 |
Associated Gene/Transcript | mRpL53-RA |
Protein status: | RE16138.pep: gold |
Sequenced Size: | 841 |
Gene | Date | Evidence |
---|---|---|
mRpL53 | 2009-01-14 | Manual selection by Sue Celniker |
841 bp assembled on 2009-03-10
GenBank Submission: BT072874.1
> RE16138.complete GCTATCGTCGCTCAGCTGTTACGTAGCGTGTTTGTTACGTCGTAAATTTT GTGCGGAAAAACCGCAGAGTTTTCATTGCCGCCGTGAAAAAAACATAAAT AATGTCTGTGCCTTTCAGTGGCGCATTGCGGCGTTCCGGCGGCATTGTGT CCGCCATTGGCAAGCAGCTGAAGAGCGTGAATTTGAAGGGCGTCAAGCGG ATAACCGTGCAGTTCGATCCATTCGCGGAAAATGTCAAGTCCACACGGGA ATTCCTCTTCCTGCTCTCCACACCCAAAGTGGCAGCTACGAATCCCAAGT GCGTGGTCAAGCCAGAAATCGTCTGCGATCGCCAGCCGGCCAACATCAAG TTTGCCCTGATTGATTCAGCGCAAGAACAAGCCCAAGTCAAGGAGATCCG CTTCAACAGCGATAACCTAAACACACTAGAGCTGCTGCAGCTGTGCAACA AGCACGTGTCCAGCTTGGCACCGCGCGAGGAGATCACCAACAAGGTCCTG ACCAAGGCGGAGAAACAGAAACTAGCAGGAGGCGCCGGCGGCGGAAAGAA GGCAACCAAGAAGAAGTAACCATCAGGATGGTGAGGAAGCACAAAGGAAC ACTGGCGGTGATCGAGAAGATCTACCAGGATATACCCGCATTCTCCGACA TCTTCACCGAGGAGAGCTTCTACATGTTCGCCTTCTGTTTCGTGTGCGCC ACCATTCTGGTGGCCTTCATTCTCTCCCGGTTCATCACCATCAAGCCCGT CGATTTCTAAGCCAATTGTATTGTTCAATTCCGCACACGTACTTTTCAAA ATATATATACGCTCTAACATGTAACAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 9842548..9842999 | 374..825 | 2260 | 100 | Plus |
chr2R | 21145070 | chr2R | 9841534..9841781 | 1..248 | 1240 | 100 | Plus |
chr2R | 21145070 | chr2R | 9842251..9842379 | 247..375 | 645 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 13955213..13955667 | 374..828 | 2275 | 100 | Plus |
2R | 25286936 | 2R | 13954199..13954446 | 1..248 | 1240 | 100 | Plus |
2R | 25286936 | 2R | 13954916..13955044 | 247..375 | 645 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 13956412..13956866 | 374..828 | 2275 | 100 | Plus |
2R | 25260384 | 2R | 13955398..13955645 | 1..248 | 1240 | 100 | Plus |
2R | 25260384 | 2R | 13956115..13956243 | 247..375 | 645 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 9841534..9841780 | 1..247 | 100 | -> | Plus |
chr2R | 9842252..9842379 | 248..375 | 100 | -> | Plus |
chr2R | 9842550..9842999 | 376..825 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL53-RA | 1..468 | 102..569 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL53-RA | 1..468 | 102..569 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL53-RA | 1..468 | 102..569 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL53-RA | 1..468 | 102..569 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33155-RC | 1..825 | 1..825 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33155-RC | 1..825 | 1..825 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL53-RA | 5..829 | 1..825 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL53-RA | 5..829 | 1..825 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 13954917..13955044 | 248..375 | 100 | -> | Plus |
2R | 13954199..13954445 | 1..247 | 100 | -> | Plus |
2R | 13955215..13955664 | 376..825 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 13954917..13955044 | 248..375 | 100 | -> | Plus |
2R | 13954199..13954445 | 1..247 | 100 | -> | Plus |
2R | 13955215..13955664 | 376..825 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 13954917..13955044 | 248..375 | 100 | -> | Plus |
2R | 13954199..13954445 | 1..247 | 100 | -> | Plus |
2R | 13955215..13955664 | 376..825 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 9841704..9841950 | 1..247 | 100 | -> | Plus |
arm_2R | 9842422..9842549 | 248..375 | 100 | -> | Plus |
arm_2R | 9842720..9843169 | 376..825 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 13955398..13955644 | 1..247 | 100 | -> | Plus |
2R | 13956116..13956243 | 248..375 | 100 | -> | Plus |
2R | 13956414..13956863 | 376..825 | 100 | Plus |
Translation from 101 to 568
> RE16138.pep MSVPFSGALRRSGGIVSAIGKQLKSVNLKGVKRITVQFDPFAENVKSTRE FLFLLSTPKVAATNPKCVVKPEIVCDRQPANIKFALIDSAQEQAQVKEIR FNSDNLNTLELLQLCNKHVSSLAPREEITNKVLTKAEKQKLAGGAGGGKK ATKKK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF13720-PA | 155 | GF13720-PA | 1..139 | 1..139 | 667 | 92.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG20412-PA | 155 | GG20412-PA | 1..155 | 1..155 | 783 | 98.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH22824-PA | 156 | GH22824-PA | 1..141 | 1..141 | 605 | 90.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpL53-PA | 155 | CG30481-PA | 1..155 | 1..155 | 773 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI21202-PA | 154 | GI21202-PA | 1..143 | 1..143 | 582 | 86.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL17398-PA | 152 | GL17398-PA | 1..152 | 1..155 | 620 | 86.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA17351-PA | 152 | GA17351-PA | 1..152 | 1..155 | 623 | 87.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM23256-PA | 155 | GM23256-PA | 1..155 | 1..155 | 771 | 96.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD10993-PA | 155 | GD10993-PA | 1..155 | 1..155 | 773 | 96.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ20803-PA | 152 | GJ20803-PA | 1..137 | 1..137 | 641 | 89.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK17949-PA | 155 | GK17949-PA | 1..139 | 1..139 | 656 | 89.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE12572-PA | 155 | GE12572-PA | 1..155 | 1..155 | 791 | 98.7 | Plus |
Translation from 101 to 568
> RE16138.hyp MSVPFSGALRRSGGIVSAIGKQLKSVNLKGVKRITVQFDPFAENVKSTRE FLFLLSTPKVAATNPKCVVKPEIVCDRQPANIKFALIDSAQEQAQVKEIR FNSDNLNTLELLQLCNKHVSSLAPREEITNKVLTKAEKQKLAGGAGGGKK ATKKK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpL53-PA | 155 | CG30481-PA | 1..155 | 1..155 | 773 | 100 | Plus |