Clone RE16337 Report

Search the DGRC for RE16337

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:163
Well:37
Vector:pFlc-1
Associated Gene/TranscriptCG9921-RB
Protein status:RE16337.pep: gold
Preliminary Size:553
Sequenced Size:806

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9921 2001-12-14 Blastp of sequenced clone
CG9921 2002-01-01 Sim4 clustering to Release 2
CG9921 2003-01-01 Sim4 clustering to Release 3
CG9921 2008-04-29 Release 5.5 accounting
CG9921 2008-08-15 Release 5.9 accounting
CG9921 2008-12-18 5.12 accounting

Clone Sequence Records

RE16337.complete Sequence

806 bp (806 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071104

> RE16337.complete
GTGGACAAATTAGTAGATGTGTAATTTTGAACGTTTCTTGATGTTTGTCG
TTTTGGAAGTCGTGATAGTTCGAGAAAACTATCGCTTTATTAGTGTGAAC
GCACGCACATCGTAAGCGTTGGTGTCATCTCCAATTGAATAATAGAATTT
GACTTGCTTGATATTGTTTTACTAATATTGCCCGGGACTAAGAGCGATAT
GTCGAACAAAATTGAAGTCTCGCTTCCGGAGGAGGAACTGGATTGGATAC
AATTGCGCCAGGACCTGGGACCCGTTGCCGAGGTGGAAACGACCAAGGAG
AAGTTGCAGCGCAAGATCAAGGAGAATCCGCTGGTTCCGTTGGGATGTTT
GGCCACTACAGCGGCGCTCACAGCTGGCTTATACAACTTTCGCACTGGCA
ATCGCAAGATGTCGCAGCTGATGATGCGAAGTCGTATCGCGGCTCAGGGA
TTTACCGTTATGGCCCTAGTTGTCGGCGTCGTCATGACCTACACTGATAA
AAAATAACTACAACGATATTATTATGAACCCAAATATATAGGCTGAATTT
GCATTCAGTTGGATTCTGTTATTTTTTTTTTTTAGTCCCATGTTACAAAA
AGCTAATACTAAGGGCTGCAAATTTGTATAAATATTTAAATATACGCTAA
CCATTACATAGATGGTATCTAAAAGATGCCTATAGATAATACTTATAAAA
TGTCTCAATTTATTGTAATCAAATGTGGGAAATCTTAAGGGGCTACTATT
AATGTGATAGTTTTAGCTGTGATTAAAAAATAGTTTCAAACAAAAAAAAA
AAAAAA

RE16337.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:41:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG9921-RA 804 CG9921-RA 1..792 4..794 3905 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:10:05
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 16221008..16221454 790..343 2160 99.3 Minus
chrX 22417052 chrX 16221536..16221852 344..29 1520 99.4 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:37:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:10:03
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 16331274..16331726 794..343 2200 99.6 Minus
X 23542271 X 16331808..16332123 344..29 1580 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:08:32
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 16339372..16339824 794..343 2210 99.5 Minus
X 23527363 X 16339906..16340221 344..29 1580 100 Minus
Blast to na_te.dros performed 2019-03-15 20:10:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dbuz\ISBu2 726 Dbuz\ISBu2 ISBU2 726bp 318..397 564..643 130 62.5 Plus

RE16337.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:10:55 Download gff for RE16337.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 16221007..16221453 344..791 99 <- Minus
chrX 16221537..16221851 30..343 99 <- Minus
chrX 16221994..16222021 1..29 93   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:57:55 Download gff for RE16337.complete
Subject Subject Range Query Range Percent Splice Strand
CG9921-RA 1..309 199..507 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:06:44 Download gff for RE16337.complete
Subject Subject Range Query Range Percent Splice Strand
CG9921-RA 1..309 199..507 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:07:22 Download gff for RE16337.complete
Subject Subject Range Query Range Percent Splice Strand
CG9921-RB 1..309 199..507 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:31:14 Download gff for RE16337.complete
Subject Subject Range Query Range Percent Splice Strand
CG9921-RA 1..309 199..507 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:16:54 Download gff for RE16337.complete
Subject Subject Range Query Range Percent Splice Strand
CG9921-RB 1..309 199..507 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:35:10 Download gff for RE16337.complete
Subject Subject Range Query Range Percent Splice Strand
CG9921-RA 1..788 4..791 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:06:44 Download gff for RE16337.complete
Subject Subject Range Query Range Percent Splice Strand
CG9921-RA 1..788 4..791 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:07:22 Download gff for RE16337.complete
Subject Subject Range Query Range Percent Splice Strand
CG9921-RC 226..985 29..787 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:31:14 Download gff for RE16337.complete
Subject Subject Range Query Range Percent Splice Strand
CG9921-RA 1..788 4..791 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:16:54 Download gff for RE16337.complete
Subject Subject Range Query Range Percent Splice Strand
CG9921-RC 226..985 29..787 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:10:55 Download gff for RE16337.complete
Subject Subject Range Query Range Percent Splice Strand
X 16331277..16331725 344..791 99 <- Minus
X 16331809..16332122 30..343 100 <- Minus
X 16332264..16332291 1..29 93   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:10:55 Download gff for RE16337.complete
Subject Subject Range Query Range Percent Splice Strand
X 16331277..16331725 344..791 99 <- Minus
X 16331809..16332122 30..343 100 <- Minus
X 16332264..16332291 1..29 93   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:10:55 Download gff for RE16337.complete
Subject Subject Range Query Range Percent Splice Strand
X 16331277..16331725 344..791 99 <- Minus
X 16331809..16332122 30..343 100 <- Minus
X 16332264..16332291 1..29 93   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:07:22 Download gff for RE16337.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 16225310..16225758 344..791 99 <- Minus
arm_X 16225842..16226155 30..343 100 <- Minus
arm_X 16226297..16226324 1..29 93   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:07:43 Download gff for RE16337.complete
Subject Subject Range Query Range Percent Splice Strand
X 16339375..16339823 344..791 99 <- Minus
X 16339907..16340220 30..343 100 <- Minus
X 16340362..16340389 1..29 93   Minus

RE16337.hyp Sequence

Translation from 198 to 506

> RE16337.hyp
MSNKIEVSLPEEELDWIQLRQDLGPVAEVETTKEKLQRKIKENPLVPLGC
LATTAALTAGLYNFRTGNRKMSQLMMRSRIAAQGFTVMALVVGVVMTYTD
KK*

RE16337.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:40:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG9921-PC 102 CG9921-PC 1..102 1..102 510 100 Plus
CG9921-PB 102 CG9921-PB 1..102 1..102 510 100 Plus

RE16337.pep Sequence

Translation from 198 to 506

> RE16337.pep
MSNKIEVSLPEEELDWIQLRQDLGPVAEVETTKEKLQRKIKENPLVPLGC
LATTAALTAGLYNFRTGNRKMSQLMMRSRIAAQGFTVMALVVGVVMTYTD
KK*

RE16337.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:52:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19615-PA 102 GF19615-PA 1..102 1..102 488 88.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:52:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19329-PA 102 GG19329-PA 1..102 1..102 519 97.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:52:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12463-PA 102 GH12463-PA 1..102 1..102 457 82.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:41:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG9921-PC 102 CG9921-PC 1..102 1..102 510 100 Plus
CG9921-PB 102 CG9921-PB 1..102 1..102 510 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:52:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11141-PA 102 GI11141-PA 1..102 1..102 460 81.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:52:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15894-PA 104 GL15894-PA 1..102 1..102 477 86.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:52:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22125-PA 104 GA22125-PA 1..102 1..102 477 86.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:52:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13407-PA 102 GM13407-PA 1..102 1..102 532 99 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:52:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15754-PA 102 GD15754-PA 1..102 1..102 532 99 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:52:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18698-PA 102 GJ18698-PA 1..102 1..102 460 82.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:52:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10064-PA 102 GK10064-PA 1..102 1..102 486 87.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:52:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15976-PA 102 GE15976-PA 1..102 1..102 528 98 Plus