Clone RE16487 Report

Search the DGRC for RE16487

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:164
Well:87
Vector:pFlc-1
Associated Gene/TranscriptCG5013-RA
Protein status:RE16487.pep: gold
Sequenced Size:975

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5013 2001-12-14 Blastp of sequenced clone
CG5013 2002-01-01 Sim4 clustering to Release 2
CG5013 2003-01-01 Sim4 clustering to Release 3
CG5013 2008-04-29 Release 5.5 accounting
CG5013 2008-08-15 Release 5.9 accounting
CG5013 2008-12-18 5.12 accounting

Clone Sequence Records

RE16487.complete Sequence

975 bp (975 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071109

> RE16487.complete
ATCGCAACGAAGTGACATCGCTAATCAAACAGGTTGTAAACAAAACGCTG
AAAAATAACTTTAGTTTAGTGAAAATAGTAATACTCCTGCATGCTTGAGC
TAAGATGCGTTTCCACATGAAGAGCGGCAGCGAGGACAATGACATTGTGG
CGGCCACAGCCACTGCCGAGCATATCCGCAAGTTTGTCTTCAGCGGATCA
CCCGCCGAGCGACTGGAGATCAAAATACCTGAGCTGCTTCAGGGTGCCTA
CTCCTTCTACACATGGCCTTGCGCACCAATTTTAGCCCACTTCCTGTGGG
AGCGCCGACAGACACTGGCGGGCAAGCGCATCCTGGAGCTGGGAAGCGGC
ACCGCCCTGCCCGGCATTCTGGCGGCCAAATGCCGCGCCCAAGTGGTACT
TACTGACAACTGCATTCTGCCCAAGTCACTGGCCCATATCCGAAAGTCCT
GCCTGGCCAATCAACTGCAGCCGGGCGTTGATATCGATGTGGTGGGCCTG
AGTTGGGGCCTGCTGCTGAACAGCGTGTTCCGACTGCCGCCTCTGGACCT
TATCATTGCAGCAGACTGCTTCTACGATCCCAGCGTGTTCGAGGATATCG
TGGTCACAGTTGCTTTTCTGCTGGAGCGAAATGCCGGGGCCAAATTTATA
TTTACATACCAGGAGCGGAGCGCCGACTGGTCCATAGAGGCGCTGCTCAA
GAAGTGGAAGCTGCAGGCTTTACCCATCAGCATGGAGGACATTGGCAAGG
AGTCGGGAGTGGATCTGCTGGAGTTTATGGGCGGACACACTATTCATCTT
CTGGAGATCACGCGCATCGAAAGCGATGGCTCAATAAATACAACATAACA
ATTATACAATTGGCTTTTTTTATGCTGAATGTCAAATCTCTCTTAGTTAA
TGTTCTACACGGGAATGCTCCCAAACATCAAATAAATATTTGCCTGTGGT
AATCGCTCGAAAAAAAAAAAAAAAA

RE16487.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:40:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG5013-RA 1075 CG5013-RA 77..1038 1..962 4795 99.8 Plus
CG5013.a 917 CG5013.a 44..903 103..962 4285 99.8 Plus
CG5013.a 917 CG5013.a 14..45 1..32 160 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:22:46
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 11874544..11875269 232..957 3615 99.9 Plus
chr3R 27901430 chr3R 11874262..11874494 1..233 1165 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:37:58 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:22:44
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 16049966..16050696 232..962 3640 99.9 Plus
3R 32079331 3R 16049684..16049916 1..233 1165 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:07:14
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 15790797..15791527 232..962 3640 99.8 Plus
3R 31820162 3R 15790515..15790747 1..233 1165 100 Plus
Blast to na_te.dros performed on 2019-03-16 19:22:45 has no hits.

RE16487.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:23:53 Download gff for RE16487.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 11874262..11874494 1..233 100 -> Plus
chr3R 11874546..11875271 234..959 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:58:06 Download gff for RE16487.complete
Subject Subject Range Query Range Percent Splice Strand
CG5013-RA 1..744 105..848 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:04:38 Download gff for RE16487.complete
Subject Subject Range Query Range Percent Splice Strand
CG5013-RA 1..744 105..848 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:38:01 Download gff for RE16487.complete
Subject Subject Range Query Range Percent Splice Strand
CG5013-RA 1..744 105..848 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:29:21 Download gff for RE16487.complete
Subject Subject Range Query Range Percent Splice Strand
CG5013-RA 1..744 105..848 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:29:03 Download gff for RE16487.complete
Subject Subject Range Query Range Percent Splice Strand
CG5013-RA 1..744 105..848 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:32:13 Download gff for RE16487.complete
Subject Subject Range Query Range Percent Splice Strand
CG5013-RA 14..972 1..959 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:04:38 Download gff for RE16487.complete
Subject Subject Range Query Range Percent Splice Strand
CG5013-RA 14..972 1..959 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:38:01 Download gff for RE16487.complete
Subject Subject Range Query Range Percent Splice Strand
CG5013-RA 15..973 1..959 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:29:21 Download gff for RE16487.complete
Subject Subject Range Query Range Percent Splice Strand
CG5013-RA 14..972 1..959 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:29:03 Download gff for RE16487.complete
Subject Subject Range Query Range Percent Splice Strand
CG5013-RA 15..973 1..959 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:23:53 Download gff for RE16487.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16049684..16049916 1..233 100 -> Plus
3R 16049968..16050693 234..959 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:23:53 Download gff for RE16487.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16049684..16049916 1..233 100 -> Plus
3R 16049968..16050693 234..959 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:23:53 Download gff for RE16487.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16049684..16049916 1..233 100 -> Plus
3R 16049968..16050693 234..959 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:38:01 Download gff for RE16487.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11875406..11875638 1..233 100 -> Plus
arm_3R 11875690..11876415 234..959 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:05:20 Download gff for RE16487.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15790515..15790747 1..233 100 -> Plus
3R 15790799..15791524 234..959 99   Plus

RE16487.pep Sequence

Translation from 104 to 847

> RE16487.pep
MRFHMKSGSEDNDIVAATATAEHIRKFVFSGSPAERLEIKIPELLQGAYS
FYTWPCAPILAHFLWERRQTLAGKRILELGSGTALPGILAAKCRAQVVLT
DNCILPKSLAHIRKSCLANQLQPGVDIDVVGLSWGLLLNSVFRLPPLDLI
IAADCFYDPSVFEDIVVTVAFLLERNAGAKFIFTYQERSADWSIEALLKK
WKLQALPISMEDIGKESGVDLLEFMGGHTIHLLEITRIESDGSINTT*

RE16487.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:34:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11913-PA 252 GF11913-PA 1..251 1..246 1179 92.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:34:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16975-PA 247 GG16975-PA 1..247 1..247 1271 96 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:34:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18761-PA 255 GH18761-PA 1..246 1..239 1099 86.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:49:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG5013-PA 247 CG5013-PA 1..247 1..247 1274 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:34:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22652-PA 244 GI22652-PA 1..239 1..236 1085 85.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:34:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12217-PA 248 GL12217-PA 1..247 1..246 1218 92.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:34:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18595-PA 248 GA18595-PA 1..247 1..246 1215 91.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:34:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24281-PA 247 GM24281-PA 1..247 1..247 1306 99.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:34:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19071-PA 247 GD19071-PA 1..247 1..247 1306 99.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:34:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23380-PA 255 GJ23380-PA 1..246 1..239 1097 84.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:34:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13257-PA 236 GK13257-PA 1..219 1..219 1005 86.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:34:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24363-PA 247 GE24363-PA 1..247 1..247 1282 97.6 Plus

RE16487.hyp Sequence

Translation from 104 to 847

> RE16487.hyp
MRFHMKSGSEDNDIVAATATAEHIRKFVFSGSPAERLEIKIPELLQGAYS
FYTWPCAPILAHFLWERRQTLAGKRILELGSGTALPGILAAKCRAQVVLT
DNCILPKSLAHIRKSCLANQLQPGVDIDVVGLSWGLLLNSVFRLPPLDLI
IAADCFYDPSVFEDIVVTVAFLLERNAGAKFIFTYQERSADWSIEALLKK
WKLQALPISMEDIGKESGVDLLEFMGGHTIHLLEITRIESDGSINTT*

RE16487.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:07:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG5013-PA 247 CG5013-PA 1..247 1..247 1274 100 Plus