RE16553.complete Sequence
1061 bp (1061 high quality bases) assembled on 2001-12-14
GenBank Submission: AY071110
> RE16553.complete
ACTAACTTAACCGACATTTGATCTGTCAACGTGCCACAGGAGCAGCAGCC
GATTTAGTCCGCGGAACCTCTGAACACTCGAGTTGCACCGCGTATCCTGT
CTTTGCATCCCAGAGTGCTCAATTCCAAATCGATCCTTTAAAATAATTGC
ATCGCGGCTTCTGTGCTTTTCGGTCAGTGAGTTTTTTCAGCGGCATTTGG
AATTCGCTCAGCAGTAGCAGCAGCAGCAGCCAGACGTGCCCCATCCCGTG
CCCATAGCATCACAATGAACTCCCTTCACGCCCACCTCCTACTGCTGGCA
GTTTGCTGCGTCGGCTACATCGCCAGCTCCCCGGTAATTGGCCAGGATCA
GCGCAGCGGAGACAGCGATGCCGATGTCCTGCTGGCCGCCGACGAGATGG
CCGACAACGGTGGCGACAACATCGACAAGCGGGTGGAGCGGTACGCCTTC
GGTCTGGGACGACGGGCCTATATGTACACGAACGGCGGACCGGGCATGAA
GCGCCTGCCGGTCTATAACTTCGGTCTGGGCAAGAGGTCTCGTCCCTACT
CCTTCGGACTGGGCAAACGCAGCGACTACGACTACGACCAGGACAACGAG
ATCGACTACAGAGTGCCGCCAGCGAACTACTTGGCAGCCGAGCGTGCTGT
GCGACCTGGCCGACAGAACAAGCGAACGACGCGTCCGCAACCCTTCAACT
TTGGCCTGGGCCGACGTTAAGTCAATGCTGGCCACCACTCTCCCCGGATG
GCGCACTTATTCAAATCCAGCCGTGCGCCATTTGACTAGGAGCTCATCCT
AACTAATGTTATCGAAAAAGCACTTGCAAAAGCTCTCAGACTCTTCTCCA
AACTTAAGTCACACATTCGGGAGGCAATCTAAATCTAAATGTCTGCGAAT
CCAAACGAATTCTTTGCACGCCCCTCGTCCCACAAATATTTATTGTATGA
ATCGCTAGAGCCAATGGTATTTATGTTAAGTTCTTCAAATCGATGCGTTT
AACGGCACCCTCTAAATTATATACTATGACAAATGGCGAAAAAATCGAAA
AAAAAAAAAAA
RE16553.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 19:46:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Ast-RA | 1473 | Ast-RA | 16..1073 | 4..1061 | 5275 | 99.9 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:58:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3R | 27901430 | chr3R | 20584613..20585053 | 649..209 | 2175 | 99.5 | Minus |
chr3R | 27901430 | chr3R | 20584155..20584556 | 1046..645 | 1995 | 99.8 | Minus |
chr3R | 27901430 | chr3R | 20588064..20588268 | 208..4 | 1025 | 100 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:37:59 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:58:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 24761390..24761830 | 649..209 | 2205 | 100 | Minus |
3R | 32079331 | 3R | 24760917..24761333 | 1061..645 | 2055 | 99.5 | Minus |
3R | 32079331 | 3R | 24764853..24765057 | 208..4 | 1025 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:12:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 31820162 | 3R | 24502221..24502661 | 649..209 | 2205 | 100 | Minus |
3R | 31820162 | 3R | 24501748..24502164 | 1061..645 | 2055 | 99.5 | Minus |
3R | 31820162 | 3R | 24505684..24505888 | 208..4 | 1025 | 100 | Minus |
Blast to na_te.dros performed on 2019-03-16 20:58:05 has no hits.
RE16553.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:58:49 Download gff for
RE16553.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3R | 20584154..20584551 | 650..1047 | 99 | <- | Minus |
chr3R | 20584613..20585031 | 231..649 | 99 | == | Minus |
chr3R | 20588064..20588269 | 1..208 | 99 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:58:07 Download gff for
RE16553.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Ast-RA | 1..456 | 265..720 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:13:49 Download gff for
RE16553.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Ast-RA | 1..456 | 265..720 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:31:07 Download gff for
RE16553.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Ast-RA | 1..456 | 265..720 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed on 2008-07-21 19:38:51 has no hits.
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:01:19 Download gff for
RE16553.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
AstA-RA | 1..456 | 265..720 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:45:10 Download gff for
RE16553.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Ast-RA | 1..1044 | 4..1047 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:13:49 Download gff for
RE16553.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Ast-RA | 1..1044 | 4..1047 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:31:07 Download gff for
RE16553.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Ast-RA | 13..1057 | 1..1047 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:38:51 Download gff for
RE16553.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Ast-RA | 1..1044 | 4..1047 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:01:19 Download gff for
RE16553.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
AstA-RA | 13..1057 | 1..1047 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:58:49 Download gff for
RE16553.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 24760931..24761328 | 650..1047 | 99 | <- | Minus |
3R | 24761390..24761830 | 209..649 | 100 | <- | Minus |
3R | 24764853..24765058 | 1..208 | 99 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:58:49 Download gff for
RE16553.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 24760931..24761328 | 650..1047 | 99 | <- | Minus |
3R | 24761390..24761830 | 209..649 | 100 | <- | Minus |
3R | 24764853..24765058 | 1..208 | 99 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:58:49 Download gff for
RE16553.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 24760931..24761328 | 650..1047 | 99 | <- | Minus |
3R | 24761390..24761830 | 209..649 | 100 | <- | Minus |
3R | 24764853..24765058 | 1..208 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:31:07 Download gff for
RE16553.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 20586653..20587050 | 650..1047 | 99 | <- | Minus |
arm_3R | 20587112..20587552 | 209..649 | 100 | <- | Minus |
arm_3R | 20590575..20590780 | 1..208 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:15:40 Download gff for
RE16553.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 24501762..24502159 | 650..1047 | 99 | <- | Minus |
3R | 24502221..24502661 | 209..649 | 100 | <- | Minus |
3R | 24505684..24505889 | 1..208 | 99 | | Minus |
RE16553.pep Sequence
Translation from 264 to 719
> RE16553.pep
MNSLHAHLLLLAVCCVGYIASSPVIGQDQRSGDSDADVLLAADEMADNGG
DNIDKRVERYAFGLGRRAYMYTNGGPGMKRLPVYNFGLGKRSRPYSFGLG
KRSDYDYDQDNEIDYRVPPANYLAAERAVRPGRQNKRTTRPQPFNFGLGR
R*
RE16553.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:22:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF23184-PA | 154 | GF23184-PA | 1..154 | 1..151 | 729 | 90.3 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:22:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG12326-PA | 151 | GG12326-PA | 1..151 | 1..151 | 751 | 96.7 | Plus |
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:22:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dgri\GH19129-PA | 157 | GH19129-PA | 18..157 | 17..151 | 496 | 72.3 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:42:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
AstA-PB | 151 | CG13633-PB | 1..151 | 1..151 | 805 | 100 | Plus |
AstA-PA | 151 | CG13633-PA | 1..151 | 1..151 | 805 | 100 | Plus |
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:22:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dmoj\GI23586-PA | 156 | GI23586-PA | 1..156 | 1..151 | 526 | 67.7 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:22:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL13866-PA | 153 | GL13866-PA | 1..153 | 1..151 | 641 | 87.7 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:22:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA12425-PA | 153 | GA12425-PA | 1..153 | 1..151 | 641 | 87.7 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:22:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM23467-PA | 151 | GM23467-PA | 1..151 | 1..151 | 781 | 98.7 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:22:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD18275-PA | 151 | GD18275-PA | 1..151 | 1..151 | 788 | 100 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:22:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ23562-PA | 156 | GJ23562-PA | 1..156 | 1..151 | 511 | 73 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:22:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK13247-PA | 157 | GK13247-PA | 14..157 | 13..151 | 541 | 72.9 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:22:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE10779-PA | 150 | GE10779-PA | 1..150 | 1..151 | 757 | 96.7 | Plus |
RE16553.hyp Sequence
Translation from 264 to 719
> RE16553.hyp
MNSLHAHLLLLAVCCVGYIASSPVIGQDQRSGDSDADVLLAADEMADNGG
DNIDKRVERYAFGLGRRAYMYTNGGPGMKRLPVYNFGLGKRSRPYSFGLG
KRSDYDYDQDNEIDYRVPPANYLAAERAVRPGRQNKRTTRPQPFNFGLGR
R*
RE16553.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:51:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
AstA-PB | 151 | CG13633-PB | 1..151 | 1..151 | 805 | 100 | Plus |
AstA-PA | 151 | CG13633-PA | 1..151 | 1..151 | 805 | 100 | Plus |