Clone RE16553 Report

Search the DGRC for RE16553

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:165
Well:53
Vector:pFlc-1
Associated Gene/TranscriptAstA-RA
Protein status:RE16553.pep: gold
Sequenced Size:1061

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13633 2001-12-14 Blastp of sequenced clone
CG13630 2002-01-01 Sim4 clustering to Release 2
CG13633 2003-01-01 Sim4 clustering to Release 3
Ast 2008-04-29 Release 5.5 accounting
Ast 2008-08-15 Release 5.9 accounting
Ast 2008-12-18 5.12 accounting

Clone Sequence Records

RE16553.complete Sequence

1061 bp (1061 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071110

> RE16553.complete
ACTAACTTAACCGACATTTGATCTGTCAACGTGCCACAGGAGCAGCAGCC
GATTTAGTCCGCGGAACCTCTGAACACTCGAGTTGCACCGCGTATCCTGT
CTTTGCATCCCAGAGTGCTCAATTCCAAATCGATCCTTTAAAATAATTGC
ATCGCGGCTTCTGTGCTTTTCGGTCAGTGAGTTTTTTCAGCGGCATTTGG
AATTCGCTCAGCAGTAGCAGCAGCAGCAGCCAGACGTGCCCCATCCCGTG
CCCATAGCATCACAATGAACTCCCTTCACGCCCACCTCCTACTGCTGGCA
GTTTGCTGCGTCGGCTACATCGCCAGCTCCCCGGTAATTGGCCAGGATCA
GCGCAGCGGAGACAGCGATGCCGATGTCCTGCTGGCCGCCGACGAGATGG
CCGACAACGGTGGCGACAACATCGACAAGCGGGTGGAGCGGTACGCCTTC
GGTCTGGGACGACGGGCCTATATGTACACGAACGGCGGACCGGGCATGAA
GCGCCTGCCGGTCTATAACTTCGGTCTGGGCAAGAGGTCTCGTCCCTACT
CCTTCGGACTGGGCAAACGCAGCGACTACGACTACGACCAGGACAACGAG
ATCGACTACAGAGTGCCGCCAGCGAACTACTTGGCAGCCGAGCGTGCTGT
GCGACCTGGCCGACAGAACAAGCGAACGACGCGTCCGCAACCCTTCAACT
TTGGCCTGGGCCGACGTTAAGTCAATGCTGGCCACCACTCTCCCCGGATG
GCGCACTTATTCAAATCCAGCCGTGCGCCATTTGACTAGGAGCTCATCCT
AACTAATGTTATCGAAAAAGCACTTGCAAAAGCTCTCAGACTCTTCTCCA
AACTTAAGTCACACATTCGGGAGGCAATCTAAATCTAAATGTCTGCGAAT
CCAAACGAATTCTTTGCACGCCCCTCGTCCCACAAATATTTATTGTATGA
ATCGCTAGAGCCAATGGTATTTATGTTAAGTTCTTCAAATCGATGCGTTT
AACGGCACCCTCTAAATTATATACTATGACAAATGGCGAAAAAATCGAAA
AAAAAAAAAAA

RE16553.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:46:24
Subject Length Description Subject Range Query Range Score Percent Strand
Ast-RA 1473 Ast-RA 16..1073 4..1061 5275 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:58:06
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 20584613..20585053 649..209 2175 99.5 Minus
chr3R 27901430 chr3R 20584155..20584556 1046..645 1995 99.8 Minus
chr3R 27901430 chr3R 20588064..20588268 208..4 1025 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:37:59 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:58:04
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24761390..24761830 649..209 2205 100 Minus
3R 32079331 3R 24760917..24761333 1061..645 2055 99.5 Minus
3R 32079331 3R 24764853..24765057 208..4 1025 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:12:50
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 24502221..24502661 649..209 2205 100 Minus
3R 31820162 3R 24501748..24502164 1061..645 2055 99.5 Minus
3R 31820162 3R 24505684..24505888 208..4 1025 100 Minus
Blast to na_te.dros performed on 2019-03-16 20:58:05 has no hits.

RE16553.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:58:49 Download gff for RE16553.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 20584154..20584551 650..1047 99 <- Minus
chr3R 20584613..20585031 231..649 99 == Minus
chr3R 20588064..20588269 1..208 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:58:07 Download gff for RE16553.complete
Subject Subject Range Query Range Percent Splice Strand
Ast-RA 1..456 265..720 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:13:49 Download gff for RE16553.complete
Subject Subject Range Query Range Percent Splice Strand
Ast-RA 1..456 265..720 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:31:07 Download gff for RE16553.complete
Subject Subject Range Query Range Percent Splice Strand
Ast-RA 1..456 265..720 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed on 2008-07-21 19:38:51 has no hits.
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:01:19 Download gff for RE16553.complete
Subject Subject Range Query Range Percent Splice Strand
AstA-RA 1..456 265..720 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:45:10 Download gff for RE16553.complete
Subject Subject Range Query Range Percent Splice Strand
Ast-RA 1..1044 4..1047 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:13:49 Download gff for RE16553.complete
Subject Subject Range Query Range Percent Splice Strand
Ast-RA 1..1044 4..1047 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:31:07 Download gff for RE16553.complete
Subject Subject Range Query Range Percent Splice Strand
Ast-RA 13..1057 1..1047 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:38:51 Download gff for RE16553.complete
Subject Subject Range Query Range Percent Splice Strand
Ast-RA 1..1044 4..1047 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:01:19 Download gff for RE16553.complete
Subject Subject Range Query Range Percent Splice Strand
AstA-RA 13..1057 1..1047 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:58:49 Download gff for RE16553.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24760931..24761328 650..1047 99 <- Minus
3R 24761390..24761830 209..649 100 <- Minus
3R 24764853..24765058 1..208 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:58:49 Download gff for RE16553.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24760931..24761328 650..1047 99 <- Minus
3R 24761390..24761830 209..649 100 <- Minus
3R 24764853..24765058 1..208 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:58:49 Download gff for RE16553.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24760931..24761328 650..1047 99 <- Minus
3R 24761390..24761830 209..649 100 <- Minus
3R 24764853..24765058 1..208 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:31:07 Download gff for RE16553.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20586653..20587050 650..1047 99 <- Minus
arm_3R 20587112..20587552 209..649 100 <- Minus
arm_3R 20590575..20590780 1..208 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:15:40 Download gff for RE16553.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24501762..24502159 650..1047 99 <- Minus
3R 24502221..24502661 209..649 100 <- Minus
3R 24505684..24505889 1..208 99   Minus

RE16553.pep Sequence

Translation from 264 to 719

> RE16553.pep
MNSLHAHLLLLAVCCVGYIASSPVIGQDQRSGDSDADVLLAADEMADNGG
DNIDKRVERYAFGLGRRAYMYTNGGPGMKRLPVYNFGLGKRSRPYSFGLG
KRSDYDYDQDNEIDYRVPPANYLAAERAVRPGRQNKRTTRPQPFNFGLGR
R*

RE16553.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:22:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23184-PA 154 GF23184-PA 1..154 1..151 729 90.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:22:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12326-PA 151 GG12326-PA 1..151 1..151 751 96.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:22:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19129-PA 157 GH19129-PA 18..157 17..151 496 72.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:42:01
Subject Length Description Subject Range Query Range Score Percent Strand
AstA-PB 151 CG13633-PB 1..151 1..151 805 100 Plus
AstA-PA 151 CG13633-PA 1..151 1..151 805 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:22:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23586-PA 156 GI23586-PA 1..156 1..151 526 67.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:22:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13866-PA 153 GL13866-PA 1..153 1..151 641 87.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:22:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12425-PA 153 GA12425-PA 1..153 1..151 641 87.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:22:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23467-PA 151 GM23467-PA 1..151 1..151 781 98.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:22:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18275-PA 151 GD18275-PA 1..151 1..151 788 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:22:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23562-PA 156 GJ23562-PA 1..156 1..151 511 73 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:22:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13247-PA 157 GK13247-PA 14..157 13..151 541 72.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:22:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10779-PA 150 GE10779-PA 1..150 1..151 757 96.7 Plus

RE16553.hyp Sequence

Translation from 264 to 719

> RE16553.hyp
MNSLHAHLLLLAVCCVGYIASSPVIGQDQRSGDSDADVLLAADEMADNGG
DNIDKRVERYAFGLGRRAYMYTNGGPGMKRLPVYNFGLGKRSRPYSFGLG
KRSDYDYDQDNEIDYRVPPANYLAAERAVRPGRQNKRTTRPQPFNFGLGR
R*

RE16553.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:51:51
Subject Length Description Subject Range Query Range Score Percent Strand
AstA-PB 151 CG13633-PB 1..151 1..151 805 100 Plus
AstA-PA 151 CG13633-PA 1..151 1..151 805 100 Plus