Clone RE16720 Report

Search the DGRC for RE16720

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:167
Well:20
Vector:pFlc-1
Associated Gene/TranscriptMED22-RA
Protein status:RE16720.pep: gold
Preliminary Size:567
Sequenced Size:648

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3034 2001-12-14 Blastp of sequenced clone
CG3034 2002-01-01 Sim4 clustering to Release 2
CG3034 2003-01-01 Sim4 clustering to Release 3
MED22 2008-04-29 Release 5.5 accounting
MED22 2008-08-15 Release 5.9 accounting
MED22 2008-12-18 5.12 accounting

Clone Sequence Records

RE16720.complete Sequence

648 bp (648 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071113

> RE16720.complete
GTGCATATAAAAAACGACGAGAAGCGGGTTTGTCTAAAATAAATTGTTGA
ACTAAGTTAAGGTAGAATTAGGACAATGGCCAGCGGATCCAGGACAACCA
TTTTGCCCCAGTCGAAGGAGGCGCTTCTGAAGTCCTATAATGCGCGCCTC
AAGGACGACGTTCGCAGCATGCTGGAGAATTTTGAAGAAATACTCAAGCT
GGCGCGCCGTGAGAGCCACAGCCAGATTTCGAAGACCACGCAGTGCGAAC
AGGATGCCCTGGAAATGCAGGTCCGCGCGGCCAACATGGTCCGTGCCGGC
GAGTCTCTGATGAAGCTGGTGGCCGACCTAAAACAGTACCTAATCCTCAA
CGACTTTCACTCGGTCAACGAGGCCATCACAAACAATTCGCAGCTGTTCA
GGAACACACAGAGCGAGTGCGACAAGAAGCTGATGAAACTTAGGGACGAA
ATGGCCATGGACTTGTACGACCTGGAGGAGGAGTACTACACCAGCATTTT
TAAGTAGCGCTAGGAGGGGAAGGGGTTCACCTTATTTGTGATGAACTGGC
TTTGGCCGAACTGTAGAATTTAATAAGAAATCATTACCACATTCACTTGT
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

RE16720.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:57:24
Subject Length Description Subject Range Query Range Score Percent Strand
MED22-RA 899 MED22-RA 233..832 4..603 3000 100 Plus
CG3708-RA 2062 CG3708-RA 1991..2062 603..532 360 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:53:54
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 822535..822846 289..600 1560 100 Plus
chrX 22417052 chrX 822130..822313 4..187 920 100 Plus
chrX 22417052 chrX 822368..822471 186..289 505 99 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:38:08 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:53:52
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 928549..928863 289..603 1575 100 Plus
X 23542271 X 928144..928327 4..187 920 100 Plus
X 23542271 X 928382..928485 186..289 520 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:16:22
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 936647..936961 289..603 1575 100 Plus
X 23527363 X 936242..936425 4..187 920 100 Plus
X 23527363 X 936480..936583 186..289 520 100 Plus
Blast to na_te.dros performed on 2019-03-16 18:53:53 has no hits.

RE16720.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:55:11 Download gff for RE16720.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 822370..822471 188..289 99 -> Plus
chrX 822127..822313 1..187 99 -> Plus
chrX 822536..822846 290..600 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:58:16 Download gff for RE16720.complete
Subject Subject Range Query Range Percent Splice Strand
MED22-RA 1..432 76..507 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:56:01 Download gff for RE16720.complete
Subject Subject Range Query Range Percent Splice Strand
MED22-RA 1..432 76..507 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:18:45 Download gff for RE16720.complete
Subject Subject Range Query Range Percent Splice Strand
MED22-RA 1..432 76..507 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:38:36 Download gff for RE16720.complete
Subject Subject Range Query Range Percent Splice Strand
MED22-RA 1..432 76..507 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:54:00 Download gff for RE16720.complete
Subject Subject Range Query Range Percent Splice Strand
MED22-RA 1..432 76..507 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:09:38 Download gff for RE16720.complete
Subject Subject Range Query Range Percent Splice Strand
MED22-RA 5..604 1..600 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:56:01 Download gff for RE16720.complete
Subject Subject Range Query Range Percent Splice Strand
MED22-RA 5..604 1..600 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:18:45 Download gff for RE16720.complete
Subject Subject Range Query Range Percent Splice Strand
MED22-RA 3..602 1..600 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:38:36 Download gff for RE16720.complete
Subject Subject Range Query Range Percent Splice Strand
MED22-RA 5..604 1..600 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:54:00 Download gff for RE16720.complete
Subject Subject Range Query Range Percent Splice Strand
MED22-RA 3..602 1..600 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:55:11 Download gff for RE16720.complete
Subject Subject Range Query Range Percent Splice Strand
X 928141..928327 1..187 99 -> Plus
X 928384..928485 188..289 100 -> Plus
X 928550..928860 290..600 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:55:11 Download gff for RE16720.complete
Subject Subject Range Query Range Percent Splice Strand
X 928141..928327 1..187 99 -> Plus
X 928384..928485 188..289 100 -> Plus
X 928550..928860 290..600 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:55:11 Download gff for RE16720.complete
Subject Subject Range Query Range Percent Splice Strand
X 928141..928327 1..187 99 -> Plus
X 928384..928485 188..289 100 -> Plus
X 928550..928860 290..600 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:18:45 Download gff for RE16720.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 822174..822360 1..187 99 -> Plus
arm_X 822417..822518 188..289 100 -> Plus
arm_X 822583..822893 290..600 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:21:39 Download gff for RE16720.complete
Subject Subject Range Query Range Percent Splice Strand
X 936648..936958 290..600 100   Plus
X 936239..936425 1..187 99 -> Plus
X 936482..936583 188..289 100 -> Plus

RE16720.pep Sequence

Translation from 75 to 506

> RE16720.pep
MASGSRTTILPQSKEALLKSYNARLKDDVRSMLENFEEILKLARRESHSQ
ISKTTQCEQDALEMQVRAANMVRAGESLMKLVADLKQYLILNDFHSVNEA
ITNNSQLFRNTQSECDKKLMKLRDEMAMDLYDLEEEYYTSIFK*

RE16720.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:31:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22114-PA 143 GF22114-PA 1..143 1..143 726 97.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:31:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12818-PA 143 GG12818-PA 1..143 1..143 749 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:31:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12360-PA 143 GH12360-PA 1..143 1..143 712 95.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:04:54
Subject Length Description Subject Range Query Range Score Percent Strand
MED22-PA 143 CG3034-PA 1..143 1..143 711 100 Plus
CG32971-PC 145 CG32971-PC 7..130 15..138 277 46.8 Plus
CG32971-PB 145 CG32971-PB 7..130 15..138 277 46.8 Plus
CG32971-PA 145 CG32971-PA 7..130 15..138 277 46.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:31:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15603-PA 143 GI15603-PA 1..143 1..143 709 94.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:31:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14209-PA 143 GL14209-PA 1..143 1..143 699 93 Plus
Dper\GL23473-PA 143 GL23473-PA 1..143 1..143 696 92.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:31:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22402-PA 143 GA22402-PA 1..143 1..143 699 93 Plus
Dpse\GA27270-PA 143 GA27270-PA 1..143 1..143 696 92.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:31:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19099-PA 143 GM19099-PA 1..143 1..143 744 99.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:31:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22347-PA 65 GD22347-PA 1..65 79..143 340 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:31:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15208-PA 143 GJ15208-PA 1..143 1..143 727 97.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:31:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24968-PA 143 GK24968-PA 1..143 1..143 728 97.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:31:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16647-PA 143 GE16647-PA 1..143 1..143 749 100 Plus

RE16720.hyp Sequence

Translation from 75 to 506

> RE16720.hyp
MASGSRTTILPQSKEALLKSYNARLKDDVRSMLENFEEILKLARRESHSQ
ISKTTQCEQDALEMQVRAANMVRAGESLMKLVADLKQYLILNDFHSVNEA
ITNNSQLFRNTQSECDKKLMKLRDEMAMDLYDLEEEYYTSIFK*

RE16720.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:53:40
Subject Length Description Subject Range Query Range Score Percent Strand
MED22-PA 143 CG3034-PA 1..143 1..143 711 100 Plus
CG32971-PC 145 CG32971-PC 7..130 15..138 277 46.8 Plus
CG32971-PB 145 CG32971-PB 7..130 15..138 277 46.8 Plus
CG32971-PA 145 CG32971-PA 7..130 15..138 277 46.8 Plus