Clone RE16858 Report

Search the DGRC for RE16858

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:168
Well:58
Vector:pFlc-1
Associated Gene/TranscriptCG18649-RA
Protein status:RE16858.pep: gold
Sequenced Size:591

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG18649-RA 2009-01-21 est gleaning
CG18649 2011-03-10 Manual selection by Sue Celniker

Clone Sequence Records

RE16858.complete Sequence

591 bp assembled on 2011-04-26

GenBank Submission: BT126378.1

> RE16858.complete
AGTTGAAAACTAAATTTGACAATACAATGCGTGCCTATTTGCTGCTTGCC
CTGTTTGGATGTGTGCTTTTGGCCACAGTTTCCGCAAATCCGGTGGACAT
TGACGACTTGGAGGACCTCGAGGAGGACAAACGAATTGCTGATGAGCAGG
ATAATGCTAACGATGATGAGAAAGACGATGAGGATTCAAATGAACCCGAG
TCCGACGACGACTTAGATGAGCCTGAATCCCCGGAGGACGATTCCCAGAA
CAATGATGATTCCGAAAGCGACGAGAGCATCCAGTACAATCAAGATGAAG
AGTAGCTCTAATGGGAATTAACCCTTTCTATTCTTTATTGTCTTTATCTA
CACGCTTTCACCGGTCGTTAGACGTTTAAACAACTGTTTACACAGAAATA
CACAGTTCATCTTCAACAACCAAATAAGTAAAGGTTTTTATGTTATTCTA
GTAAATACACACATTTCTGGAAACACCCATCATAATTGGTGCTTTTTACT
TAACTTCTTTTTATACAGCTCTTAAATGATTTTGTAAAGAATTACATACT
AAACAAAATCTTAAAAAAAAAAAAAAAGAAAAAAAAAAAAA

RE16858.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 10:34:59
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 15043613..15044179 567..1 2820 99.8 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 10:34:57
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15053563..15054129 567..1 2835 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:11:26
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 15046663..15047229 567..1 2835 100 Minus
Blast to na_te.dros performed on 2019-03-15 10:34:58 has no hits.

RE16858.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 10:35:48 Download gff for RE16858.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 15043618..15044179 1..562 99   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-04-27 15:22:48 Download gff for RE16858.complete
Subject Subject Range Query Range Percent Splice Strand
CG18649-RA 1..279 27..305 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:20:28 Download gff for RE16858.complete
Subject Subject Range Query Range Percent Splice Strand
CG18649-RA 1..279 27..305 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:07:07 Download gff for RE16858.complete
Subject Subject Range Query Range Percent Splice Strand
CG18649-RA 1..279 27..305 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-04-27 15:22:48 Download gff for RE16858.complete
Subject Subject Range Query Range Percent Splice Strand
CG18649-RA 5..487 1..483 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:20:28 Download gff for RE16858.complete
Subject Subject Range Query Range Percent Splice Strand
CG18649-RB 7..568 1..562 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:07:07 Download gff for RE16858.complete
Subject Subject Range Query Range Percent Splice Strand
CG18649-RB 7..568 1..562 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:35:48 Download gff for RE16858.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15053568..15054129 1..562 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:35:48 Download gff for RE16858.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15053568..15054129 1..562 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:35:48 Download gff for RE16858.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15053568..15054129 1..562 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:20:28 Download gff for RE16858.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15046668..15047229 1..562 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:06:38 Download gff for RE16858.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15046668..15047229 1..562 100   Minus

RE16858.hyp Sequence

Translation from 2 to 304

> RE16858.hyp
LKTKFDNTMRAYLLLALFGCVLLATVSANPVDIDDLEDLEEDKRIADEQD
NANDDEKDDEDSNEPESDDDLDEPESPEDDSQNNDDSESDESIQYNQDEE
*

RE16858.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:33:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG18649-PB 92 CG18649-PB 1..92 9..100 478 100 Plus
CG18649-PA 92 CG18649-PA 1..92 9..100 478 100 Plus
l(2)01289-PG 1191 CG9432-PG 828..899 29..100 149 38.9 Plus
l(2)01289-PM 1193 CG9432-PM 828..899 29..100 149 38.9 Plus

RE16858.pep Sequence

Translation from 2 to 304

> RE16858.pep
LKTKFDNTMRAYLLLALFGCVLLATVSANPVDIDDLEDLEEDKRIADEQD
NANDDEKDDEDSNEPESDDDLDEPESPEDDSQNNDDSESDESIQYNQDEE
*

RE16858.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 18:48:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10746-PA 101 GF10746-PA 1..60 9..63 136 58.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 18:48:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13689-PA 97 GG13689-PA 1..90 9..98 183 74.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:11:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG18649-PB 92 CG18649-PB 1..92 9..100 478 100 Plus
CG18649-PA 92 CG18649-PA 1..92 9..100 478 100 Plus
l(2)01289-PG 1191 CG9432-PG 828..899 29..100 149 38.9 Plus
l(2)01289-PM 1193 CG9432-PM 828..899 29..100 149 38.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 18:48:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25866-PA 90 GL25866-PA 1..59 9..69 133 56.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 18:48:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23645-PA 90 GA23645-PA 1..90 9..100 137 51.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:48:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24509-PA 96 GM24509-PA 1..96 9..100 271 90.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 18:48:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12581-PA 96 GD12581-PA 1..96 9..100 271 91.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:48:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19984-PA 117 GE19984-PA 1..43 9..51 214 95.3 Plus