BDGP Sequence Production Resources |
Search the DGRC for RE16858
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 168 |
Well: | 58 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG18649-RA |
Protein status: | RE16858.pep: gold |
Sequenced Size: | 591 |
Gene | Date | Evidence |
---|---|---|
CG18649-RA | 2009-01-21 | est gleaning |
CG18649 | 2011-03-10 | Manual selection by Sue Celniker |
591 bp assembled on 2011-04-26
GenBank Submission: BT126378.1
> RE16858.complete AGTTGAAAACTAAATTTGACAATACAATGCGTGCCTATTTGCTGCTTGCC CTGTTTGGATGTGTGCTTTTGGCCACAGTTTCCGCAAATCCGGTGGACAT TGACGACTTGGAGGACCTCGAGGAGGACAAACGAATTGCTGATGAGCAGG ATAATGCTAACGATGATGAGAAAGACGATGAGGATTCAAATGAACCCGAG TCCGACGACGACTTAGATGAGCCTGAATCCCCGGAGGACGATTCCCAGAA CAATGATGATTCCGAAAGCGACGAGAGCATCCAGTACAATCAAGATGAAG AGTAGCTCTAATGGGAATTAACCCTTTCTATTCTTTATTGTCTTTATCTA CACGCTTTCACCGGTCGTTAGACGTTTAAACAACTGTTTACACAGAAATA CACAGTTCATCTTCAACAACCAAATAAGTAAAGGTTTTTATGTTATTCTA GTAAATACACACATTTCTGGAAACACCCATCATAATTGGTGCTTTTTACT TAACTTCTTTTTATACAGCTCTTAAATGATTTTGTAAAGAATTACATACT AAACAAAATCTTAAAAAAAAAAAAAAAGAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 15043613..15044179 | 567..1 | 2820 | 99.8 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 15053563..15054129 | 567..1 | 2835 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 15046663..15047229 | 567..1 | 2835 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 15043618..15044179 | 1..562 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18649-RA | 1..279 | 27..305 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18649-RA | 1..279 | 27..305 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18649-RA | 1..279 | 27..305 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18649-RA | 5..487 | 1..483 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18649-RB | 7..568 | 1..562 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18649-RB | 7..568 | 1..562 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 15053568..15054129 | 1..562 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 15053568..15054129 | 1..562 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 15053568..15054129 | 1..562 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 15046668..15047229 | 1..562 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 15046668..15047229 | 1..562 | 100 | Minus |
Translation from 2 to 304
> RE16858.hyp LKTKFDNTMRAYLLLALFGCVLLATVSANPVDIDDLEDLEEDKRIADEQD NANDDEKDDEDSNEPESDDDLDEPESPEDDSQNNDDSESDESIQYNQDEE *
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG18649-PB | 92 | CG18649-PB | 1..92 | 9..100 | 478 | 100 | Plus |
CG18649-PA | 92 | CG18649-PA | 1..92 | 9..100 | 478 | 100 | Plus |
l(2)01289-PG | 1191 | CG9432-PG | 828..899 | 29..100 | 149 | 38.9 | Plus |
l(2)01289-PM | 1193 | CG9432-PM | 828..899 | 29..100 | 149 | 38.9 | Plus |
Translation from 2 to 304
> RE16858.pep LKTKFDNTMRAYLLLALFGCVLLATVSANPVDIDDLEDLEEDKRIADEQD NANDDEKDDEDSNEPESDDDLDEPESPEDDSQNNDDSESDESIQYNQDEE *
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF10746-PA | 101 | GF10746-PA | 1..60 | 9..63 | 136 | 58.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG13689-PA | 97 | GG13689-PA | 1..90 | 9..98 | 183 | 74.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG18649-PB | 92 | CG18649-PB | 1..92 | 9..100 | 478 | 100 | Plus |
CG18649-PA | 92 | CG18649-PA | 1..92 | 9..100 | 478 | 100 | Plus |
l(2)01289-PG | 1191 | CG9432-PG | 828..899 | 29..100 | 149 | 38.9 | Plus |
l(2)01289-PM | 1193 | CG9432-PM | 828..899 | 29..100 | 149 | 38.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL25866-PA | 90 | GL25866-PA | 1..59 | 9..69 | 133 | 56.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA23645-PA | 90 | GA23645-PA | 1..90 | 9..100 | 137 | 51.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM24509-PA | 96 | GM24509-PA | 1..96 | 9..100 | 271 | 90.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD12581-PA | 96 | GD12581-PA | 1..96 | 9..100 | 271 | 91.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE19984-PA | 117 | GE19984-PA | 1..43 | 9..51 | 214 | 95.3 | Plus |