Clone RE16882 Report

Search the DGRC for RE16882

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:168
Well:82
Vector:pFlc-1
Associated Gene/TranscriptArf51F-RA
Protein status:RE16882.pep: gold
Preliminary Size:1296
Sequenced Size:1366

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8156 2001-12-14 Blastp of sequenced clone
CG8156 2002-01-01 Sim4 clustering to Release 2
CG8156 2003-01-01 Sim4 clustering to Release 3
Arf51F 2008-04-29 Release 5.5 accounting
Arf51F 2008-08-15 Release 5.9 accounting
Arf51F 2008-12-18 5.12 accounting

Clone Sequence Records

RE16882.complete Sequence

1366 bp (1366 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071116

> RE16882.complete
GCATTTTTTAGCGTATTTTCTGGAATTCCCGAAGATCTTGTTCCGCTCTG
CGCTAACGGGCACATTGCTTCGTGTATGTGTATATAAATACAAGAAGATT
AGTGCAAAATTGTTGTTGTTAGTTATAGTTTTTTGGCCGCCGTGTGCTAG
CAAATGCATTTTATGCCCCGGCCCGCGCACTTTGGCACTACATGTTAACG
GATTTCAGGCTGGCGTGGAACGAATTGGGCTGGAAAGCGATTGGCTAAGG
TTTAATGGATGACACATCAGCACCATGGGAAAGTTACTATCAAAAATTTT
CGGCAACAAGGAAATGCGAATTCTCATGCTCGGACTGGACGCGGCTGGAA
AAACAACGATTCTGTACAAACTGAAACTTGGCCAATCTGTTACAACGATA
CCCACTGTGGGCTTTAATGTGGAAACCGTCACCTATAAGAATGTCAAGTT
CAATGTGTGGGACGTCGGTGGGCAGGATAAGATTCGACCGCTATGGCGAC
ACTATTACACGGGTACACAGGGTCTGATCTTCGTCGTGGATTGTGCGGAT
CGGGATCGGATAGACGAGGCGCGCACGGAGCTGCATAGGATAATTAACGA
TAGGGAGATGCGCGACGCCATCATACTGATATTTGCTAACAAGCAGGATC
TGCCTGATGCAATGAAACCCCATGAAATCCAGGAAAAACTAGGTTTAACT
AGAATAAGAGATCGCAATTGGTATGTACAACCATCATGTGCCACATCCGG
CGATGGCCTGTCCGAGGGCCTCATTTGGTTAACGTCGAACCATAAGTTAT
GAGAATCGTAATCGAGCATTTTCTTATATGTATGTATATGGCATGTATTA
TTCGAAGCGAAGCAAAAGCGAAAATATTCTATTTTATTTATACAAAGAAA
ACCAACCGCAAGCGCATAGTAAAAACTCAATTCGTAAAAACGAACGTACA
TAAATTACAAATGTTAAAAATGGTATATAGAAGTCAGATATATATAGTAA
TTATATATACTCTCAATTAACCAACCAATATTCTCACTAGTAAAAATACA
CATACCTACAAAATAAAAGAAGCATCAAAATAAGCAGCCGGTAAATATCC
GTAAAGTAAATTATGCGTGAAGCACAGAGACATAAAGCAAAACATCAACG
GAGATTAGCCTTAAGTAAGTTTTTCTTGTAAATTATATTGATGAGACACG
TAAGCAATAAGTTGAAAGCTTGTTTATTGCAACTGTTACTATATTTGACT
TGAGCAAGGGTGTAACGAGTCTTAAATAAATTGTAAATAAATATTCAAAT
TAAAGCCCATATACAACAACAAACGAAATAAAAGAAAACACCGAACAAAC
AAAAAAAAAAAAAAAA

RE16882.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:57:19
Subject Length Description Subject Range Query Range Score Percent Strand
Arf51F-RB 1920 Arf51F-RB 82..1433 1..1352 6760 100 Plus
Arf51F.c 1909 Arf51F.c 268..1381 239..1352 5570 100 Plus
Arf51F-RA 1868 Arf51F-RA 268..1381 239..1352 5570 100 Plus
Arf51F.c 1909 Arf51F.c 1..239 1..239 1195 100 Plus
Arf51F-RA 1868 Arf51F-RA 1..239 1..239 1195 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:58:44
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 11211410..11212102 659..1350 3355 99.3 Plus
chr2R 21145070 chr2R 11211050..11211356 353..659 1505 99.3 Plus
chr2R 21145070 chr2R 11209683..11209921 1..239 1195 100 Plus
chr2R 21145070 chr2R 11210657..11210774 239..356 590 100 Plus
chr3L 24539361 chr3L 22858766..22858869 402..299 220 80.8 Minus
chr4 1351717 chr4 1144929..1145135 336..542 210 73.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:38:17 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:58:42
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 15324201..15324894 659..1352 3470 100 Plus
2R 25286936 2R 15323841..15324147 353..659 1520 99.7 Plus
2R 25286936 2R 15322474..15322712 1..239 1195 100 Plus
2R 25286936 2R 15323448..15323565 239..356 590 100 Plus
3L 28110227 3L 22869850..22869953 402..299 220 80.8 Minus
4 1348131 4 1124442..1124648 336..542 210 73.4 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:16:19
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 15325400..15326093 659..1352 3470 100 Plus
2R 25260384 2R 15325040..15325346 353..659 1520 99.6 Plus
2R 25260384 2R 15323673..15323911 1..239 1195 100 Plus
2R 25260384 2R 15324647..15324764 239..356 590 100 Plus
3L 28103327 3L 22862950..22863053 402..299 220 80.7 Minus
Blast to na_te.dros performed 2019-03-16 20:58:42
Subject Length Description Subject Range Query Range Score Percent Strand
412 7567 412 412 7567bp 6775..7019 864..1112 127 55.9 Plus
Quasimodo 7387 Quasimodo QUASIMODO 7387bp Derived from P1 clones DS08479 & DS07153 by Sue Celniker, 29 March 2001. 6537..6679 874..1018 117 55.5 Plus
G7 1192 G7 G7 1192bp 1134..1170 908..872 113 78.4 Minus

RE16882.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:00:12 Download gff for RE16882.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 11209683..11209921 1..239 100 -> Plus
chr2R 11210658..11210774 240..356 100 -> Plus
chr2R 11211054..11211356 357..659 99 -> Plus
chr2R 11211411..11212102 660..1350 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:58:24 Download gff for RE16882.complete
Subject Subject Range Query Range Percent Splice Strand
Arf51F-RC 1..528 275..802 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:55:54 Download gff for RE16882.complete
Subject Subject Range Query Range Percent Splice Strand
Arf51F-RC 1..528 275..802 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:31:14 Download gff for RE16882.complete
Subject Subject Range Query Range Percent Splice Strand
Arf51F-RC 1..528 275..802 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:38:30 Download gff for RE16882.complete
Subject Subject Range Query Range Percent Splice Strand
Arf51F-RC 1..528 275..802 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:01:43 Download gff for RE16882.complete
Subject Subject Range Query Range Percent Splice Strand
Arf51F-RC 1..528 275..802 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:09:30 Download gff for RE16882.complete
Subject Subject Range Query Range Percent Splice Strand
Arf51F-RB 1..1350 1..1350 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:55:54 Download gff for RE16882.complete
Subject Subject Range Query Range Percent Splice Strand
Arf51F-RB 1..1350 1..1350 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:31:14 Download gff for RE16882.complete
Subject Subject Range Query Range Percent Splice Strand
Arf51F-RB 1..1323 28..1350 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:38:31 Download gff for RE16882.complete
Subject Subject Range Query Range Percent Splice Strand
Arf51F-RB 1..1350 1..1350 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:01:43 Download gff for RE16882.complete
Subject Subject Range Query Range Percent Splice Strand
Arf51F-RB 1..1323 28..1350 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:00:12 Download gff for RE16882.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15322474..15322712 1..239 100 -> Plus
2R 15323449..15323565 240..356 100 -> Plus
2R 15323845..15324147 357..659 100 -> Plus
2R 15324202..15324892 660..1350 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:00:12 Download gff for RE16882.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15322474..15322712 1..239 100 -> Plus
2R 15323449..15323565 240..356 100 -> Plus
2R 15323845..15324147 357..659 100 -> Plus
2R 15324202..15324892 660..1350 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:00:12 Download gff for RE16882.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15322474..15322712 1..239 100 -> Plus
2R 15323449..15323565 240..356 100 -> Plus
2R 15323845..15324147 357..659 100 -> Plus
2R 15324202..15324892 660..1350 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:31:14 Download gff for RE16882.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 11209979..11210217 1..239 100 -> Plus
arm_2R 11210954..11211070 240..356 100 -> Plus
arm_2R 11211350..11211652 357..659 100 -> Plus
arm_2R 11211707..11212397 660..1350 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:21:31 Download gff for RE16882.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15323673..15323911 1..239 100 -> Plus
2R 15324648..15324764 240..356 100 -> Plus
2R 15325044..15325346 357..659 100 -> Plus
2R 15325401..15326091 660..1350 100   Plus

RE16882.pep Sequence

Translation from 274 to 801

> RE16882.pep
MGKLLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVE
TVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEAR
TELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWY
VQPSCATSGDGLSEGLIWLTSNHKL*

RE16882.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:30:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13030-PA 175 GF13030-PA 1..175 1..175 923 97.7 Plus
Dana\GF23441-PA 182 GF23441-PA 5..178 1..174 669 70.1 Plus
Dana\GF23416-PA 180 GF23416-PA 5..175 1..171 643 66.1 Plus
Dana\GF24106-PA 180 GF24106-PA 1..174 1..171 482 51.1 Plus
Dana\GF16955-PA 184 GF16955-PA 11..183 4..174 445 48.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:30:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20511-PA 175 GG20511-PA 1..175 1..175 932 100 Plus
Dere\GG13164-PA 182 GG13164-PA 5..178 1..174 669 70.1 Plus
Dere\GG16407-PA 180 GG16407-PA 5..175 1..171 639 66.7 Plus
Dere\GG15940-PA 190 GG15940-PA 21..185 8..172 476 51.5 Plus
Dere\GG15097-PA 179 GG15097-PA 1..172 1..169 440 45.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:30:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20425-PA 175 GH20425-PA 1..175 1..175 909 97.7 Plus
Dgri\GH14762-PA 182 GH14762-PA 5..178 1..174 669 70.1 Plus
Dgri\GH23951-PA 180 GH23951-PA 5..175 1..171 640 65.5 Plus
Dgri\GH14763-PA 182 GH14763-PA 8..175 4..171 589 63.1 Plus
Dgri\GH14778-PA 180 GH14778-PA 1..174 1..171 482 51.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:07:42
Subject Length Description Subject Range Query Range Score Percent Strand
Arf51F-PE 175 CG8156-PE 1..175 1..175 921 100 Plus
Arf51F-PA 175 CG8156-PA 1..175 1..175 921 100 Plus
Arf51F-PC 175 CG8156-PC 1..175 1..175 921 100 Plus
Arf51F-PB 175 CG8156-PB 1..175 1..175 921 100 Plus
Arf51F-PD 175 CG8156-PD 1..175 1..175 921 100 Plus
Arf79F-PJ 182 CG8385-PJ 8..178 4..174 652 71.3 Plus
Arf79F-PI 182 CG8385-PI 8..178 4..174 652 71.3 Plus
Arf79F-PH 182 CG8385-PH 8..178 4..174 652 71.3 Plus
Arf79F-PF 182 CG8385-PF 8..178 4..174 652 71.3 Plus
Arf79F-PC 182 CG8385-PC 8..178 4..174 652 71.3 Plus
Arf79F-PE 182 CG8385-PE 8..178 4..174 652 71.3 Plus
Arf79F-PB 182 CG8385-PB 8..178 4..174 652 71.3 Plus
Arf79F-PA 182 CG8385-PA 8..178 4..174 652 71.3 Plus
Arf102F-PB 180 CG11027-PB 5..175 1..171 624 66.1 Plus
Arf102F-PA 180 CG11027-PA 5..175 1..171 624 66.1 Plus
Arl1-PA 180 CG6025-PA 1..174 1..171 473 51.1 Plus
dnd-PA 179 CG6560-PA 6..178 4..174 433 48 Plus
Arl5-PA 179 CG7197-PA 1..177 1..174 430 45.2 Plus
Arl2-PA 184 CG7435-PA 15..175 12..172 353 43.2 Plus
Arl4-PA 312 CG2219-PA 13..160 2..144 342 45.9 Plus
Arl4-PB 313 CG2219-PB 26..161 14..144 335 48.5 Plus
Arl8-PC 186 CG7891-PC 15..182 8..174 300 34.5 Plus
Arl8-PB 186 CG7891-PB 15..182 8..174 300 34.5 Plus
Arl8-PA 186 CG7891-PA 15..182 8..174 300 34.5 Plus
Arfrp1-PA 200 CG7039-PA 20..183 16..169 274 37.7 Plus
Arl6-PB 201 CG7735-PB 17..178 13..169 256 35.8 Plus
Arl6-PA 202 CG7735-PA 17..179 13..169 256 35.6 Plus
Sar1-PE 193 CG7073-PE 19..151 12..144 233 33.1 Plus
Sar1-PC 193 CG7073-PC 19..151 12..144 233 33.1 Plus
Sar1-PD 193 CG7073-PD 19..151 12..144 233 33.1 Plus
Sar1-PA 193 CG7073-PA 19..151 12..144 233 33.1 Plus
Arl4-PC 100 CG2219-PC 13..93 2..77 217 51.9 Plus
CG17819-PA 186 CG17819-PA 17..177 10..169 216 31.3 Plus
Rab35-PB 201 CG9575-PB 10..126 15..128 142 30.8 Plus
Rab35-PD 201 CG9575-PD 10..126 15..128 142 30.8 Plus
Rab35-PA 201 CG9575-PA 10..126 15..128 142 30.8 Plus
Rab4-PA 213 CG4921-PA 10..128 15..129 141 30.8 Plus
Rab4-PB 213 CG4921-PB 10..128 15..129 141 30.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:30:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19608-PA 175 GI19608-PA 1..175 1..175 914 98.3 Plus
Dmoj\GI11864-PA 182 GI11864-PA 5..178 1..174 669 70.1 Plus
Dmoj\GI14031-PA 180 GI14031-PA 5..175 1..171 641 66.1 Plus
Dmoj\GI11881-PA 180 GI11881-PA 1..174 1..171 483 51.1 Plus
Dmoj\GI15002-PA 196 GI15002-PA 9..170 4..166 464 48.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:30:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17751-PA 175 GL17751-PA 1..175 1..175 918 97.7 Plus
Dper\GL25178-PA 182 GL25178-PA 5..178 1..174 669 70.1 Plus
Dper\GL18404-PA 180 GL18404-PA 5..175 1..171 639 65.5 Plus
Dper\GL24385-PA 181 GL24385-PA 5..177 1..174 554 59.4 Plus
Dper\GL12747-PA 180 GL12747-PA 1..174 1..171 484 51.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:30:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20856-PA 175 GA20856-PA 1..175 1..175 918 97.7 Plus
Dpse\GA21036-PA 182 GA21036-PA 5..178 1..174 669 70.1 Plus
Dpse\GA10714-PA 180 GA10714-PA 5..175 1..171 639 65.5 Plus
Dpse\GA23613-PA 181 GA23613-PA 5..177 1..174 554 59.4 Plus
Dpse\GA19306-PA 180 GA19306-PA 1..174 1..171 484 51.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:30:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21603-PA 175 GM21603-PA 1..175 1..175 932 100 Plus
Dsec\GM22073-PA 182 GM22073-PA 5..178 1..174 669 70.1 Plus
Dsec\GM13026-PA 180 GM13026-PA 5..175 1..171 638 66.1 Plus
Dsec\GM25571-PA 180 GM25571-PA 1..174 1..171 482 51.1 Plus
Dsec\GM24953-PA 179 GM24953-PA 1..172 1..169 440 45.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:30:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11108-PA 175 GD11108-PA 1..175 1..175 932 100 Plus
Dsim\GD12049-PA 182 GD12049-PA 5..178 1..174 669 70.1 Plus
Dsim\GD20493-PA 180 GD20493-PA 5..175 1..171 638 66.1 Plus
Dsim\GD14586-PA 180 GD14586-PA 1..174 1..171 482 51.1 Plus
Dsim\GD13004-PA 179 GD13004-PA 1..172 1..169 440 45.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:30:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14973-PA 175 GJ14973-PA 1..175 1..175 914 98.3 Plus
Dvir\GJ13559-PA 182 GJ13559-PA 5..178 1..174 669 70.1 Plus
Dvir\GJ19602-PA 180 GJ19602-PA 5..175 1..171 641 66.1 Plus
Dvir\GJ13575-PA 180 GJ13575-PA 1..174 1..171 483 51.1 Plus
Dvir\GJ15360-PA 193 GJ15360-PA 1..169 1..166 453 48.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:30:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20891-PA 175 GK20891-PA 1..175 1..175 916 98.3 Plus
Dwil\GK20496-PA 182 GK20496-PA 5..178 1..174 669 70.1 Plus
Dwil\GK13623-PA 180 GK13623-PA 5..175 1..171 643 66.1 Plus
Dwil\GK24495-PA 167 GK24495-PA 1..161 11..171 472 52.2 Plus
Dwil\GK13011-PA 193 GK13011-PA 29..192 11..174 446 49.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:30:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13644-PA 175 GE13644-PA 1..175 1..175 932 100 Plus
Dyak\GE19486-PA 182 GE19486-PA 5..178 1..174 669 70.1 Plus
Dyak\Arf102F-PA 180 GE14567-PA 5..175 1..171 646 67.3 Plus
Dyak\GE22880-PA 180 GE22880-PA 1..174 1..171 482 51.1 Plus
Dyak\GE24074-PA 179 GE24074-PA 6..178 4..174 441 48 Plus

RE16882.hyp Sequence

Translation from 274 to 801

> RE16882.hyp
MGKLLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVE
TVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEAR
TELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWY
VQPSCATSGDGLSEGLIWLTSNHKL*

RE16882.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:44:47
Subject Length Description Subject Range Query Range Score Percent Strand
Arf51F-PE 175 CG8156-PE 1..175 1..175 921 100 Plus
Arf51F-PA 175 CG8156-PA 1..175 1..175 921 100 Plus
Arf51F-PC 175 CG8156-PC 1..175 1..175 921 100 Plus
Arf51F-PB 175 CG8156-PB 1..175 1..175 921 100 Plus
Arf51F-PD 175 CG8156-PD 1..175 1..175 921 100 Plus