Clone RE17056 Report

Search the DGRC for RE17056

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:170
Well:56
Vector:pFlc-1
Associated Gene/TranscriptPDCD-5-RA
Protein status:RE17056.pep: gold
Preliminary Size:402
Sequenced Size:660

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13072 2001-12-14 Blastp of sequenced clone
CG13072 2002-01-01 Sim4 clustering to Release 2
CG13072 2003-01-01 Sim4 clustering to Release 3
PDCD-5 2008-04-29 Release 5.5 accounting
PDCD-5 2008-08-15 Release 5.9 accounting
PDCD-5 2008-12-18 5.12 accounting

Clone Sequence Records

RE17056.complete Sequence

660 bp (660 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071119

> RE17056.complete
AATTGCAAGGTCACACTGTTCAATCGCACACTTTTTTTGCTACAAAGAGC
GTGATTTATTTTTATAGAAGCAAAAAAAGCAATAATTACTTAATTTACTG
CCATAAATATACTGAGAATAAGAACCCAGAATGTCGGATAGTGATTTGGA
TGCCTTACGCGCGCAGCGCATGTCCCAAATGCAGTCGCAATTCGGCGGCG
GCAATGATGCGGAAAAGCAACAAGCCCAGCAGGAGCAGATGCGCGCCCAG
GAGGAAATGAAGCACTCGATATTATCCCAAGTTCTGGACCAGCAGGCCAG
GGCACGACTTAATACCCTCAAAGTCAGCAAGCCGGAGAAGGCGCAAATGT
TCGAGAACATGGTCATCCGCATGGCCCAGATGGGTCAGGTGCGTGGAAAA
CTTGATGACGCCCAGTTCGTCAGCATCCTCGAAAGCGTCAATGCTCAGAT
GCCGCAGAGCAAGTCCTCCGTGAAATACGATCGGCGGCGGGCGGCCATCG
ATAGCGACGACGACGAGGATTACGGCTGCTGATTCGTCCGAAATTCCGCC
CAACATCTAATTTAAGTTATGCCCGCTCCTCACATCCGCTAAATCATGTT
TATTACTTTTACTAACTTAAAACGAGAAACAAAACTAGATGCCCAAAAAA
AAAAAAAAAA

RE17056.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:40:33
Subject Length Description Subject Range Query Range Score Percent Strand
PDCD-5-RA 723 PDCD-5-RA 4..650 1..647 3220 99.8 Plus
PDCD-5.a 520 PDCD-5.a 70..520 194..644 2255 100 Plus
PDCD-5.b 629 PDCD-5.b 309..629 324..644 1605 100 Plus
PDCD-5.b 629 PDCD-5.b 1..309 1..309 1530 99.6 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:58:30
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 16220765..16221100 644..309 1680 100 Minus
chr3L 24539361 chr3L 16221523..16221716 194..1 955 99.5 Minus
chr3L 24539361 chr3L 16221158..16221272 308..194 575 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:38:21 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:58:28
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16231078..16231416 647..309 1695 100 Minus
3L 28110227 3L 16231839..16232032 194..1 955 99.5 Minus
3L 28110227 3L 16231474..16231588 308..194 575 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:07:38
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 16224178..16224516 647..309 1695 100 Minus
3L 28103327 3L 16224939..16225132 194..1 955 99.4 Minus
3L 28103327 3L 16224574..16224688 308..194 575 100 Minus
Blast to na_te.dros performed on 2019-03-16 11:58:28 has no hits.

RE17056.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:59:12 Download gff for RE17056.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 16221158..16221272 194..308 100 <- Minus
chr3L 16221524..16221716 1..193 99   Minus
chr3L 16220765..16221100 309..644 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:58:29 Download gff for RE17056.complete
Subject Subject Range Query Range Percent Splice Strand
PDCD-5-RA 1..402 131..532 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:05:19 Download gff for RE17056.complete
Subject Subject Range Query Range Percent Splice Strand
PDCD-5-RA 1..402 131..532 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:40:41 Download gff for RE17056.complete
Subject Subject Range Query Range Percent Splice Strand
PDCD-5-RA 1..402 131..532 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:29:57 Download gff for RE17056.complete
Subject Subject Range Query Range Percent Splice Strand
PDCD-5-RA 1..402 131..532 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:32:19 Download gff for RE17056.complete
Subject Subject Range Query Range Percent Splice Strand
PDCD-5-RA 1..402 131..532 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:33:07 Download gff for RE17056.complete
Subject Subject Range Query Range Percent Splice Strand
PDCD-5-RA 1..644 1..644 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:05:19 Download gff for RE17056.complete
Subject Subject Range Query Range Percent Splice Strand
PDCD-5-RA 1..644 1..644 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:40:41 Download gff for RE17056.complete
Subject Subject Range Query Range Percent Splice Strand
PDCD-5-RA 7..650 1..644 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:29:58 Download gff for RE17056.complete
Subject Subject Range Query Range Percent Splice Strand
PDCD-5-RA 1..644 1..644 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:32:19 Download gff for RE17056.complete
Subject Subject Range Query Range Percent Splice Strand
PDCD-5-RA 7..650 1..644 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:59:12 Download gff for RE17056.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16231081..16231416 309..644 100 <- Minus
3L 16231474..16231588 194..308 100 <- Minus
3L 16231840..16232032 1..193 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:59:12 Download gff for RE17056.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16231081..16231416 309..644 100 <- Minus
3L 16231474..16231588 194..308 100 <- Minus
3L 16231840..16232032 1..193 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:59:12 Download gff for RE17056.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16231081..16231416 309..644 100 <- Minus
3L 16231474..16231588 194..308 100 <- Minus
3L 16231840..16232032 1..193 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:40:41 Download gff for RE17056.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16224181..16224516 309..644 100 <- Minus
arm_3L 16224574..16224688 194..308 100 <- Minus
arm_3L 16224940..16225132 1..193 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:06:05 Download gff for RE17056.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16224181..16224516 309..644 100 <- Minus
3L 16224574..16224688 194..308 100 <- Minus
3L 16224940..16225132 1..193 99   Minus

RE17056.hyp Sequence

Translation from 130 to 531

> RE17056.hyp
MSDSDLDALRAQRMSQMQSQFGGGNDAEKQQAQQEQMRAQEEMKHSILSQ
VLDQQARARLNTLKVSKPEKAQMFENMVIRMAQMGQVRGKLDDAQFVSIL
ESVNAQMPQSKSSVKYDRRRAAIDSDDDEDYGC*

RE17056.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:04:13
Subject Length Description Subject Range Query Range Score Percent Strand
PDCD-5-PA 133 CG13072-PA 1..133 1..133 661 100 Plus

RE17056.pep Sequence

Translation from 130 to 531

> RE17056.pep
MSDSDLDALRAQRMSQMQSQFGGGNDAEKQQAQQEQMRAQEEMKHSILSQ
VLDQQARARLNTLKVSKPEKAQMFENMVIRMAQMGQVRGKLDDAQFVSIL
ESVNAQMPQSKSSVKYDRRRAAIDSDDDEDYGC*

RE17056.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:37:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10314-PA 135 GF10314-PA 1..135 1..133 659 96.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:37:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13487-PA 135 GG13487-PA 1..135 1..133 663 97.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:37:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15624-PA 135 GH15624-PA 1..135 1..133 651 94.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:21:41
Subject Length Description Subject Range Query Range Score Percent Strand
PDCD-5-PA 133 CG13072-PA 1..133 1..133 661 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:37:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12672-PA 131 GI12672-PA 1..131 1..133 567 91 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:37:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18027-PA 135 GL18027-PA 1..135 1..133 654 95.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:37:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12022-PA 135 GA12022-PA 1..135 1..133 650 94.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:37:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24437-PA 133 GM24437-PA 1..133 1..133 669 97.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:37:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12504-PA 133 GD12504-PA 1..133 1..133 673 98.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:37:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12652-PA 131 GJ12652-PA 1..131 1..133 565 91.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:37:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25167-PA 135 GK25167-PA 1..135 1..133 649 94.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:37:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22580-PA 135 GE22580-PA 1..135 1..133 663 97.8 Plus
Dyak\GE22893-PA 117 GE22893-PA 1..117 1..133 492 84.4 Plus