Clone RE17113 Report

Search the DGRC for RE17113

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:171
Well:13
Vector:pFlc-1
Associated Gene/TranscriptCG13679-RB
Protein status:RE17113.pep: gold
Preliminary Size:438
Sequenced Size:503

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13679 2001-12-14 Blastp of sequenced clone
CG13679 2002-01-01 Sim4 clustering to Release 2
CG13679 2003-01-01 Sim4 clustering to Release 3
CG13679 2008-04-29 Release 5.5 accounting
CG13679 2008-08-15 Release 5.9 accounting
CG13679 2008-12-18 5.12 accounting

Clone Sequence Records

RE17113.complete Sequence

503 bp (503 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071121

> RE17113.complete
ATCAAACCTAGCTCACAGCTCCCAGTAGTCACTTCTACCAAACAAAGCAC
CAATCAACAATCAACATGAAATTCATCGCCGTCTGCTTCTTCGCTGTTGT
GGCTGTGGCTGCTGCCAAGCCTGGACTTGTGGCTCCTCTGGCCGCCGCTC
CTCTGGCCTACACCGCTCCGGCTGTGGTGGGCAGTGCCGCGTACGTGGCT
CCCTATGCCTCCAGCTACAGCGCCCACTCGGTGGCTCACAGCGCAGCCTT
CCCAGCTGCCTACACCGCCGCCTACACCGCTCCCGTTGCTGCCGCCTATA
CCGCTCCAGTGGCCGCTGCCTATGCCGCTCCCATCGCTCCCTACGCCGCC
GCCTACACCTCGCCCCTGGCCTACAGCTCTCCCTATGTGGCCACCGCTGC
CGCTCCTCTGCTGCTGAAGAAGTAATTCAACGGACTGTGAATCCTACGCC
TCAATAACAAATTTTTAAATACATGATTTTAAAATCCAAAAAAAAAAAAA
AAA

RE17113.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:47:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG13679-RB 899 CG13679-RB 347..834 1..488 2440 100 Plus
CG13679-RA 501 CG13679-RA 88..501 75..488 2070 100 Plus
CG13674-RA 806 CG13674-RA 300..484 147..331 760 94 Plus
CG13674-RA 806 CG13674-RA 168..311 1..143 470 89.5 Plus
CG13674-RA 806 CG13674-RA 447..505 270..328 190 88.1 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:54:02
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 8194888..8195300 75..487 2065 100 Plus
chr3L 24539361 chr3L 8210583..8210823 331..76 810 88.7 Minus
chr3L 24539361 chr3L 8214444..8214620 86..262 750 94.9 Plus
chr3L 24539361 chr3L 8194749..8194822 1..74 355 98.6 Plus
chr3L 24539361 chr3L 8214709..8214761 339..391 250 98.1 Plus
chr3L 24539361 chr3L 8210562..8210620 328..270 190 88.1 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:38:25 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:54:00
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8202933..8203346 75..488 2070 100 Plus
3L 28110227 3L 8218602..8218842 331..76 795 88.3 Minus
3L 28110227 3L 8222475..8222792 86..391 775 83.6 Plus
3L 28110227 3L 8202794..8202867 1..74 370 100 Plus
3L 28110227 3L 8218581..8218639 328..270 190 88.1 Minus
3L 28110227 3L 8218909..8218983 74..1 190 86.7 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:36:04
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 8196033..8196446 75..488 2070 100 Plus
3L 28103327 3L 8215575..8215751 86..262 765 95.4 Plus
3L 28103327 3L 8211702..8211886 331..147 760 94 Minus
3L 28103327 3L 8195894..8195967 1..74 370 100 Plus
3L 28103327 3L 8211875..8211942 143..76 280 94.1 Minus
3L 28103327 3L 8215840..8215892 339..391 250 98.1 Plus
3L 28103327 3L 8215896..8215961 380..445 195 86.3 Plus
3L 28103327 3L 8211681..8211739 328..270 190 88.1 Minus
Blast to na_te.dros performed on 2019-03-16 18:54:00 has no hits.

RE17113.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:55:16 Download gff for RE17113.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 8194888..8195054 75..241 100 == Plus
chr3L 8195167..8195300 354..487 100   Plus
chr3L 8194749..8194822 1..74 98 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:58:32 Download gff for RE17113.complete
Subject Subject Range Query Range Percent Splice Strand
CG13679-RB 1..360 66..425 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:51:55 Download gff for RE17113.complete
Subject Subject Range Query Range Percent Splice Strand
CG13679-RB 1..360 66..425 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:18:53 Download gff for RE17113.complete
Subject Subject Range Query Range Percent Splice Strand
CG13679-RB 1..360 66..425 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:21:11 Download gff for RE17113.complete
Subject Subject Range Query Range Percent Splice Strand
CG13679-RB 1..360 66..425 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:54:07 Download gff for RE17113.complete
Subject Subject Range Query Range Percent Splice Strand
CG13679-RB 1..360 66..425 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:49:18 Download gff for RE17113.complete
Subject Subject Range Query Range Percent Splice Strand
CG13679-RB 1..487 1..487 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:51:55 Download gff for RE17113.complete
Subject Subject Range Query Range Percent Splice Strand
CG13679-RB 1..487 1..487 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:18:53 Download gff for RE17113.complete
Subject Subject Range Query Range Percent Splice Strand
CG13679-RB 3..489 1..487 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:21:11 Download gff for RE17113.complete
Subject Subject Range Query Range Percent Splice Strand
CG13679-RB 1..487 1..487 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:54:07 Download gff for RE17113.complete
Subject Subject Range Query Range Percent Splice Strand
CG13679-RB 3..489 1..487 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:55:16 Download gff for RE17113.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8202794..8202867 1..74 100 -> Plus
3L 8202933..8203345 75..487 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:55:16 Download gff for RE17113.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8202794..8202867 1..74 100 -> Plus
3L 8202933..8203345 75..487 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:55:16 Download gff for RE17113.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8202794..8202867 1..74 100 -> Plus
3L 8202933..8203345 75..487 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:18:53 Download gff for RE17113.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8195894..8195967 1..74 100 -> Plus
arm_3L 8196033..8196445 75..487 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:57:46 Download gff for RE17113.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8196033..8196445 75..487 100   Plus
3L 8195894..8195967 1..74 100 -> Plus

RE17113.pep Sequence

Translation from 65 to 424

> RE17113.pep
MKFIAVCFFAVVAVAAAKPGLVAPLAAAPLAYTAPAVVGSAAYVAPYASS
YSAHSVAHSAAFPAAYTAAYTAPVAAAYTAPVAAAYAAPIAPYAAAYTSP
LAYSSPYVATAAAPLLLKK*

RE17113.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:25:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25105-PA 132 GF25105-PA 2..132 1..119 220 74.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:25:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14287-PA 135 GG14287-PA 1..135 1..119 178 81.5 Plus
Dere\GG14290-PA 129 GG14290-PA 18..59 18..59 132 95.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:25:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15497-PA 138 GH15497-PA 19..65 18..67 158 76.9 Plus
Dgri\GH15978-PA 157 GH15978-PA 18..59 18..62 138 76.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:37:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG13679-PB 119 CG13679-PB 1..119 1..119 587 100 Plus
CG13678-PA 128 CG13678-PA 3..128 2..119 439 77.1 Plus
CG13674-PB 137 CG13674-PB 1..119 1..115 426 74.2 Plus
CG13674-PA 137 CG13674-PA 1..119 1..115 426 74.2 Plus
CG13066-PB 93 CG13066-PB 2..90 1..74 201 57.3 Plus
CG32214-PC 116 CG32214-PC 5..116 5..117 195 50.9 Plus
CG32214-PB 116 CG32214-PB 5..116 5..117 195 50.9 Plus
CG32213-PB 129 CG32213-PB 5..129 5..117 189 47.3 Plus
825-Oak-PB 129 CG32208-PB 5..129 5..117 188 48.8 Plus
CG12519-PB 131 CG12519-PB 5..131 5..117 183 44.4 Plus
CG12519-PA 131 CG12519-PA 5..131 5..117 183 44.4 Plus
CG14096-PA 122 CG14096-PA 5..122 5..117 180 45.4 Plus
CG13047-PB 170 CG13047-PB 3..160 2..115 175 38.8 Plus
CG13067-PA 79 CG13067-PA 3..78 2..97 173 47.5 Plus
CG18294-PA 141 CG18294-PA 5..141 5..117 170 43.9 Plus
CG13051-PA 83 CG13051-PA 3..79 2..90 169 48.3 Plus
CG13049-PA 181 CG13049-PA 10..127 12..114 169 40.7 Plus
Cpr64Ad-PB 247 CG1259-PB 16..135 16..115 159 46 Plus
CG13068-PA 109 CG13068-PA 8..109 6..101 157 50.5 Plus
CG13044-PA 155 CG13044-PA 9..143 10..116 156 40 Plus
Vml-PB 578 CG34333-PB 115..212 15..114 154 41 Plus
Vml-PB 578 CG34333-PB 369..468 15..114 154 42.5 Plus
Vml-PA 578 CG34333-PA 115..212 15..114 154 41 Plus
Vml-PA 578 CG34333-PA 369..468 15..114 154 42.5 Plus
Vml-PB 578 CG34333-PB 337..442 15..114 151 40.2 Plus
Vml-PA 578 CG34333-PA 337..442 15..114 151 40.2 Plus
Vml-PB 578 CG34333-PB 123..220 15..114 149 39.2 Plus
Vml-PA 578 CG34333-PA 123..220 15..114 149 39.2 Plus
CG14095-PA 162 CG14095-PA 5..142 5..118 148 36.2 Plus
Vml-PB 578 CG34333-PB 91..196 15..114 148 40.2 Plus
Vml-PB 578 CG34333-PB 274..386 13..114 148 36 Plus
Vml-PA 578 CG34333-PA 91..196 15..114 148 40.2 Plus
Vml-PA 578 CG34333-PA 274..386 13..114 148 36 Plus
Vm26Ab-PB 168 CG9046-PB 42..121 12..106 147 44.2 Plus
Vm26Ab-PA 168 CG9046-PA 42..121 12..106 147 44.2 Plus
Vml-PB 578 CG34333-PB 147..236 15..114 147 45 Plus
Vml-PA 578 CG34333-PA 147..236 15..114 147 45 Plus
CG13069-PA 97 CG13069-PA 3..97 2..119 146 44.2 Plus
Vml-PB 578 CG34333-PB 321..418 15..114 146 42.2 Plus
Vml-PA 578 CG34333-PA 321..418 15..114 146 42.2 Plus
CG11585-PB 342 CG11585-PB 130..254 15..114 146 36.2 Plus
CG32603-PA 345 CG32603-PA 107..216 12..118 145 34.8 Plus
Vml-PB 578 CG34333-PB 76..172 13..114 144 42.3 Plus
Vml-PA 578 CG34333-PA 76..172 13..114 144 42.3 Plus
CG11350-PC 456 CG11350-PC 67..173 13..114 143 44.1 Plus
Vm26Ab-PB 168 CG9046-PB 33..115 25..106 141 46.5 Plus
Vm26Ab-PA 168 CG9046-PA 33..115 25..106 141 46.5 Plus
CG32603-PA 345 CG32603-PA 203..326 15..117 140 34.9 Plus
CG14377-PB 105 CG14377-PB 1..94 1..95 138 41.3 Plus
CG14377-PA 105 CG14377-PA 1..94 1..95 138 41.3 Plus
CG14374-PA 99 CG14374-PA 1..88 1..95 135 43.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:25:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16775-PA 164 GI16775-PA 39..95 1..62 222 80.6 Plus
Dmoj\GI16628-PA 108 GI16628-PA 1..55 3..62 208 81.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:25:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22540-PA 115 GL22540-PA 2..115 1..119 196 78.3 Plus
Dper\GL22559-PA 127 GL22559-PA 1..127 1..119 185 61.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:25:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24624-PA 115 GA24624-PA 2..115 1..119 193 78.3 Plus
Dpse\GA24666-PA 419 GA24666-PA 310..419 18..119 176 63.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:25:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25028-PA 127 GM25028-PA 1..127 1..119 199 89 Plus
Dsec\GM25032-PA 128 GM25032-PA 18..128 18..119 177 74.8 Plus
Dsec\GM24957-PA 431 GM24957-PA 307..357 18..68 138 96.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:25:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14062-PA 127 GD14062-PA 1..127 1..119 482 92.1 Plus
Dsim\GD14065-PA 128 GD14065-PA 18..128 18..119 178 75.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:25:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12519-PA 131 GJ12519-PA 1..131 1..119 190 56.6 Plus
Dvir\GJ12884-PA 170 GJ12884-PA 38..90 5..62 173 84.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:25:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17005-PA 138 GK17005-PA 18..111 18..114 226 72.2 Plus
Dwil\GK17006-PA 138 GK17006-PA 18..112 18..115 221 71.4 Plus
Dwil\GK17009-PA 152 GK17009-PA 18..106 18..109 219 73.9 Plus
Dwil\GK17007-PA 140 GK17007-PA 18..106 18..109 218 73.9 Plus
Dwil\GK17008-PA 140 GK17008-PA 18..109 18..106 183 70.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:25:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20720-PA 136 GE20720-PA 18..136 18..119 187 68.1 Plus
Dyak\GE21324-PA 142 GE21324-PA 18..62 18..62 150 95.6 Plus
Dyak\GE20717-PA 142 GE20717-PA 18..62 18..62 150 95.6 Plus

RE17113.hyp Sequence

Translation from 65 to 424

> RE17113.hyp
MKFIAVCFFAVVAVAAAKPGLVAPLAAAPLAYTAPAVVGSAAYVAPYASS
YSAHSVAHSAAFPAAYTAAYTAPVAAAYTAPVAAAYAAPIAPYAAAYTSP
LAYSSPYVATAAAPLLLKK*

RE17113.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:57:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG13679-PB 119 CG13679-PB 1..119 1..119 587 100 Plus
CG13678-PA 128 CG13678-PA 3..128 2..119 439 77.1 Plus
CG13674-PB 137 CG13674-PB 1..119 1..115 426 74.2 Plus
CG13674-PA 137 CG13674-PA 1..119 1..115 426 74.2 Plus
CG13066-PB 93 CG13066-PB 2..90 1..74 201 57.3 Plus