Clone RE17222 Report

Search the DGRC for RE17222

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:172
Well:22
Vector:pFlc-1
Associated Gene/TranscriptCG31109-RA
Protein status:RE17222.pep: gold
Preliminary Size:1203
Sequenced Size:876

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31109 2001-12-14 Blastp of sequenced clone
CG13649 2002-01-01 Sim4 clustering to Release 2
CG31109 2003-01-01 Sim4 clustering to Release 3
CG31109 2008-04-29 Release 5.5 accounting
CG31109 2008-08-15 Release 5.9 accounting
CG31109 2008-12-18 5.12 accounting

Clone Sequence Records

RE17222.complete Sequence

876 bp (876 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071126

> RE17222.complete
ACATATGTACACAACACCTATCTGAAAAGTATTAAACAATATTTTGGGAA
AGTTGTTTTGGCTAGCGTTAAATTAAACGACATCCCAACCAGCAGCTGAG
GATATAGCCAACCAACAGAATCGGAATCAATCAAGATGGGGAGCATAGAA
AAGGCGTGCATATCGGGATTTCTATGCCGACTGTGTTCAGAGATGCACCG
CACAGTAATACATATTTATAGTGATCATGGCCAGCGTTTGTGTCTTGTTG
AGAAAATCAACGGTTACCTACCAATTACAATATCTCCGACTGATCCATTG
CCAAAAACCATATGCAAATCATGTCTGCATCGCGTGGAGCAGCATTACTC
GCTCCTGATGCGTCTGACGCGGATGCGGGAGGAGCGCAAGTTTAAGTTAA
TCAAATACAAAGCACAAAGAAATCCCTCGATATCCAGCGTGGAATCGGAA
GAGGACGTGATAAATTCAAGCTCGGTTCACGAGTTCCCCAATCGGAATGA
GGAGGATCAAGCGACCCGCCGCAGCGAGTCGACGAGCACCCAAGCTGAAA
CTGGTCCACAGACCCAGGAATCCCAATCCCCCAAGTCAACAAAGACCGCA
GTGTCCACACCAAACAGCAGCGAAAGCCACGATGCCAGTGGTGCTGGGCC
CAGCAATAGAGACCGAAAAGAGACTGGCACAGGCAACTCGGAAACGGGTA
GCACTACTCGGGAAGGAACCCATGCAGATTAATAACTGCTAACCTCGTCT
CTGGTCGGTGGAGCTATATATACGAGTACTTGACTATGTATATATATAGA
CGCGTTTGTGTGTACGTACGTTTAGATTGGAATAAAGTAAGCATTTTATT
TAAAAAAAAAAAAAAAAAAAAAAAAA

RE17222.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:45:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG31109.a 1300 CG31109.a 126..978 1..853 4265 100 Plus
CG31109-RA 1097 CG31109-RA 139..991 1..853 4265 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:47:38
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 20876648..20877040 851..459 1965 100 Minus
chr3R 27901430 chr3R 20877527..20877805 279..1 1395 100 Minus
chr3R 27901430 chr3R 20877213..20877350 417..280 690 100 Minus
chr3R 27901430 chr3R 20877104..20877145 459..418 210 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:38:33 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:47:36
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 25053475..25053869 853..459 1975 100 Minus
3R 32079331 3R 25054356..25054634 279..1 1395 100 Minus
3R 32079331 3R 25054042..25054179 417..280 690 100 Minus
3R 32079331 3R 25053933..25053974 459..418 210 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:12:20
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 24794306..24794700 853..459 1975 100 Minus
3R 31820162 3R 24795187..24795465 279..1 1395 100 Minus
3R 31820162 3R 24794873..24795010 417..280 690 100 Minus
3R 31820162 3R 24794764..24794805 459..418 210 100 Minus
Blast to na_te.dros performed on 2019-03-16 04:47:37 has no hits.

RE17222.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:48:25 Download gff for RE17222.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 20877527..20877805 1..279 100   Minus
chr3R 20876648..20877039 460..851 100 <- Minus
chr3R 20877104..20877145 418..459 100 <- Minus
chr3R 20877213..20877350 280..417 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:58:41 Download gff for RE17222.complete
Subject Subject Range Query Range Percent Splice Strand
CG31109-RA 1..597 136..732 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:13:00 Download gff for RE17222.complete
Subject Subject Range Query Range Percent Splice Strand
CG31109-RA 1..597 136..732 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:42:01 Download gff for RE17222.complete
Subject Subject Range Query Range Percent Splice Strand
CG31109-RA 1..597 136..732 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:37:09 Download gff for RE17222.complete
Subject Subject Range Query Range Percent Splice Strand
CG31109-RA 1..597 136..732 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:50:54 Download gff for RE17222.complete
Subject Subject Range Query Range Percent Splice Strand
CG31109-RA 1..597 136..732 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:44:04 Download gff for RE17222.complete
Subject Subject Range Query Range Percent Splice Strand
CG31109-RA 1..851 1..851 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:12:59 Download gff for RE17222.complete
Subject Subject Range Query Range Percent Splice Strand
CG31109-RA 1..851 1..851 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:42:01 Download gff for RE17222.complete
Subject Subject Range Query Range Percent Splice Strand
CG31109-RA 20..870 1..851 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:37:09 Download gff for RE17222.complete
Subject Subject Range Query Range Percent Splice Strand
CG31109-RA 1..851 1..851 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:50:54 Download gff for RE17222.complete
Subject Subject Range Query Range Percent Splice Strand
CG31109-RA 20..870 1..851 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:48:25 Download gff for RE17222.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25053477..25053868 460..851 100 <- Minus
3R 25053933..25053974 418..459 100 <- Minus
3R 25054042..25054179 280..417 100 <- Minus
3R 25054356..25054634 1..279 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:48:25 Download gff for RE17222.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25053477..25053868 460..851 100 <- Minus
3R 25053933..25053974 418..459 100 <- Minus
3R 25054042..25054179 280..417 100 <- Minus
3R 25054356..25054634 1..279 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:48:25 Download gff for RE17222.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25053477..25053868 460..851 100 <- Minus
3R 25053933..25053974 418..459 100 <- Minus
3R 25054042..25054179 280..417 100 <- Minus
3R 25054356..25054634 1..279 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:42:01 Download gff for RE17222.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20879199..20879590 460..851 100 <- Minus
arm_3R 20879655..20879696 418..459 100 <- Minus
arm_3R 20879764..20879901 280..417 100 <- Minus
arm_3R 20880078..20880356 1..279 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:14:44 Download gff for RE17222.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24794308..24794699 460..851 100 <- Minus
3R 24794764..24794805 418..459 100 <- Minus
3R 24794873..24795010 280..417 100 <- Minus
3R 24795187..24795465 1..279 100   Minus

RE17222.pep Sequence

Translation from 135 to 731

> RE17222.pep
MGSIEKACISGFLCRLCSEMHRTVIHIYSDHGQRLCLVEKINGYLPITIS
PTDPLPKTICKSCLHRVEQHYSLLMRLTRMREERKFKLIKYKAQRNPSIS
SVESEEDVINSSSVHEFPNRNEEDQATRRSESTSTQAETGPQTQESQSPK
STKTAVSTPNSSESHDASGAGPSNRDRKETGTGNSETGSTTREGTHAD*

RE17222.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:21:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17108-PA 173 GF17108-PA 1..152 1..179 454 61.1 Plus
Dana\GF22100-PA 110 GF22100-PA 1..67 1..67 177 50.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:21:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12294-PA 200 GG12294-PA 1..200 1..198 882 86.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:21:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22342-PA 99 GH22342-PA 1..96 1..96 487 90.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:13:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG31109-PB 198 CG31109-PB 1..198 1..198 1030 100 Plus
CG31109-PA 198 CG31109-PA 1..198 1..198 1030 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:21:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23979-PA 176 GI23979-PA 1..175 1..173 524 61 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:21:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21892-PA 177 GL21892-PA 1..173 1..191 584 62.9 Plus
Dper\GL14868-PA 114 GL14868-PA 1..74 1..74 189 47.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:21:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16015-PA 99 GA16015-PA 1..95 1..95 485 91.6 Plus
Dpse\GA26404-PA 109 GA26404-PA 1..74 1..74 206 51.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:21:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17760-PA 195 GM17760-PA 1..195 1..198 913 91 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:21:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18242-PA 201 GD18242-PA 1..201 1..198 961 94 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:21:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11182-PA 176 GJ11182-PA 1..110 1..107 525 88.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:21:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14356-PA 187 GK14356-PA 1..184 1..195 514 56.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:21:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10747-PA 200 GE10747-PA 1..200 1..198 866 84.7 Plus

RE17222.hyp Sequence

Translation from 135 to 731

> RE17222.hyp
MGSIEKACISGFLCRLCSEMHRTVIHIYSDHGQRLCLVEKINGYLPITIS
PTDPLPKTICKSCLHRVEQHYSLLMRLTRMREERKFKLIKYKAQRNPSIS
SVESEEDVINSSSVHEFPNRNEEDQATRRSESTSTQAETGPQTQESQSPK
STKTAVSTPNSSESHDASGAGPSNRDRKETGTGNSETGSTTREGTHAD*

RE17222.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:34:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG31109-PB 198 CG31109-PB 1..198 1..198 1030 100 Plus
CG31109-PA 198 CG31109-PA 1..198 1..198 1030 100 Plus