Clone RE17477 Report

Search the DGRC for RE17477

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:174
Well:77
Vector:pFlc-1
Associated Gene/Transcriptsmp-30-RA
Protein status:RE17477.pep: gold
Sequenced Size:1040

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7390 2001-12-14 Blastp of sequenced clone
CG7390 2002-01-01 Sim4 clustering to Release 2
CG7390 2003-01-01 Sim4 clustering to Release 3
smp-30 2008-04-29 Release 5.5 accounting
smp-30 2008-08-15 Release 5.9 accounting
smp-30 2008-12-18 5.12 accounting

Clone Sequence Records

RE17477.complete Sequence

1040 bp (1040 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071130

> RE17477.complete
AGTTTGCAAACGTTAGCTGACCGAGAAGTATTCAACGGTTTCTTTAAGAT
GTCATACAAGGTTGAAGCTGTTCCCGATTCCTACGCCGCCCTGGGCGAGG
GACCCCACTGGGATGTTGATCGCCAGAGTCTGTACTACGTGGACCTCGAA
TCCGCCGGCATTAATCGTTATGATTTCAAGCAGAACAAAGTGTACAGGGC
TAAAATCGAGGGCGAGATATTTGCATCGTTCATTCTGCCGGTTGAGAACA
AACCGCAGGAGTTTGCCGTAGGATGCGGTCTTCGTACGGTCATCGTCCAG
TGGGATGGAGTCTCCGCAGTGGCCAAGGTCACTCGCACCCTGTTCGAGGT
GCAGCCGGACCTGAAGGAAAACCGCCTTAATGATGCCAAAACCGATCCCA
ATGGCCGTTTTTACGGTGGCACCATGGCCGACAGTGGCGACATATTCACC
CAATGGAAGGGTGAGCTCTACAGCTGGCAGGCCGGTGGACAGCCCAACGC
TATCCGTAGCAAGGTGGGCATATCCAATGGCCTGGCCTGGGATGTCAAGG
CCAAGAAGTTCTACTTCATCGACACCAACAACCACGAGGTATTGGCCTAT
GACTACAATCAGAGCACCGGCGCCGTAAGCAACCCAAAGGTCATCTTCGA
TCTGAGGAAGATTCGGCCCGAAGGACCATTGTTCCCTGATGGCATGACCG
TAGACACCGATGGCAATATCTACGTGGCCACCTTCAATGGTGGCACCGTC
TTCAAGGTCAATCCAAGCACCGGTAAAATTCTGCTGGAGATCAAAATTCC
AACCACCCAAATCACCTCGGTGGCTTTTGGAGGTCCCAATTTGGATATTT
TGTATGTGACAACCGCCAACAAGTTCGACCAGCCAAAACCAGCTGGTACC
ACCTTCCAGGTCACTGGGCTCAATGCCAAGGGTTACGCCGGCGTTAATTT
GAAGATCTAGATTATAGACTACTTGTATAATAGCATTTAATTAAATAATC
AAACATTTACTTGTATACTGAACTAAAAAAAAAAAAAAAA

RE17477.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:43:33
Subject Length Description Subject Range Query Range Score Percent Strand
smp-30-RA 1257 smp-30-RA 33..1058 1..1026 5130 100 Plus
smp-30.a 1223 smp-30.a 1..1026 1..1026 5130 100 Plus
smp-30-RB 1269 smp-30-RB 33..1058 1..1026 5130 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:38:09
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 10571162..10571886 767..43 3565 99.4 Minus
chr3R 27901430 chr3R 10570847..10571105 1024..766 1235 98.5 Minus
chrX 22417052 chrX 11907066..11907783 47..764 455 70.9 Plus
chr3R 27901430 chr3R 10572030..10572077 48..1 240 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:38:43 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:38:07
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 14746407..14747131 767..43 3610 99.9 Minus
3R 32079331 3R 14746090..14746350 1026..766 1305 100 Minus
X 23542271 X 12016001..12016718 47..764 485 71.2 Plus
3R 32079331 3R 14747274..14747321 48..1 240 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:10:23
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 14487238..14487962 767..43 3610 99.8 Minus
3R 31820162 3R 14486921..14487181 1026..766 1305 100 Minus
X 23527363 X 12024099..12024195 47..143 260 84.5 Plus
3R 31820162 3R 14488105..14488152 48..1 240 100 Minus
X 23527363 X 12024566..12024642 514..590 220 85.7 Plus
X 23527363 X 12024680..12024816 628..764 190 78.2 Plus
Blast to na_te.dros performed on 2019-03-15 22:38:07 has no hits.

RE17477.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:39:14 Download gff for RE17477.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 10570847..10571103 768..1024 98 <- Minus
chr3R 10571162..10571880 49..767 99 <- Minus
chr3R 10572030..10572077 1..48 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:58:50 Download gff for RE17477.complete
Subject Subject Range Query Range Percent Splice Strand
smp-30-RB 1..912 49..960 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:09:49 Download gff for RE17477.complete
Subject Subject Range Query Range Percent Splice Strand
smp-30-RB 1..912 49..960 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:28:07 Download gff for RE17477.complete
Subject Subject Range Query Range Percent Splice Strand
smp-30-RB 1..912 49..960 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:33:58 Download gff for RE17477.complete
Subject Subject Range Query Range Percent Splice Strand
smp-30-RB 1..912 49..960 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:31:05 Download gff for RE17477.complete
Subject Subject Range Query Range Percent Splice Strand
smp-30-RB 1..912 49..960 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:39:27 Download gff for RE17477.complete
Subject Subject Range Query Range Percent Splice Strand
smp-30-RB 1..1024 1..1024 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:09:49 Download gff for RE17477.complete
Subject Subject Range Query Range Percent Splice Strand
smp-30-RB 1..1024 1..1024 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:28:07 Download gff for RE17477.complete
Subject Subject Range Query Range Percent Splice Strand
smp-30-RA 5..1028 1..1024 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:33:58 Download gff for RE17477.complete
Subject Subject Range Query Range Percent Splice Strand
smp-30-RB 1..1024 1..1024 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:31:05 Download gff for RE17477.complete
Subject Subject Range Query Range Percent Splice Strand
smp-30-RA 5..1028 1..1024 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:39:14 Download gff for RE17477.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14746092..14746348 768..1024 100 <- Minus
3R 14746407..14747125 49..767 100 <- Minus
3R 14747274..14747321 1..48 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:39:14 Download gff for RE17477.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14746092..14746348 768..1024 100 <- Minus
3R 14746407..14747125 49..767 100 <- Minus
3R 14747274..14747321 1..48 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:39:14 Download gff for RE17477.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14746092..14746348 768..1024 100 <- Minus
3R 14746407..14747125 49..767 100 <- Minus
3R 14747274..14747321 1..48 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:28:07 Download gff for RE17477.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 10571814..10572070 768..1024 100 <- Minus
arm_3R 10572129..10572847 49..767 100 <- Minus
arm_3R 10572996..10573043 1..48 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:11:08 Download gff for RE17477.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14486923..14487179 768..1024 100 <- Minus
3R 14487238..14487956 49..767 100 <- Minus
3R 14488105..14488152 1..48 100   Minus

RE17477.hyp Sequence

Translation from 0 to 959

> RE17477.hyp
SLQTLADREVFNGFFKMSYKVEAVPDSYAALGEGPHWDVDRQSLYYVDLE
SAGINRYDFKQNKVYRAKIEGEIFASFILPVENKPQEFAVGCGLRTVIVQ
WDGVSAVAKVTRTLFEVQPDLKENRLNDAKTDPNGRFYGGTMADSGDIFT
QWKGELYSWQAGGQPNAIRSKVGISNGLAWDVKAKKFYFIDTNNHEVLAY
DYNQSTGAVSNPKVIFDLRKIRPEGPLFPDGMTVDTDGNIYVATFNGGTV
FKVNPSTGKILLEIKIPTTQITSVAFGGPNLDILYVTTANKFDQPKPAGT
TFQVTGLNAKGYAGVNLKI*

RE17477.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:48:43
Subject Length Description Subject Range Query Range Score Percent Strand
smp-30-PC 306 CG7390-PC 3..306 16..319 1600 99.7 Plus
smp-30-PD 303 CG7390-PD 1..303 17..319 1599 100 Plus
smp-30-PB 303 CG7390-PB 1..303 17..319 1599 100 Plus
smp-30-PA 303 CG7390-PA 1..303 17..319 1599 100 Plus
regucalcin-PB 303 CG1803-PB 1..303 17..319 1173 71.9 Plus

RE17477.pep Sequence

Translation from 48 to 959

> RE17477.pep
MSYKVEAVPDSYAALGEGPHWDVDRQSLYYVDLESAGINRYDFKQNKVYR
AKIEGEIFASFILPVENKPQEFAVGCGLRTVIVQWDGVSAVAKVTRTLFE
VQPDLKENRLNDAKTDPNGRFYGGTMADSGDIFTQWKGELYSWQAGGQPN
AIRSKVGISNGLAWDVKAKKFYFIDTNNHEVLAYDYNQSTGAVSNPKVIF
DLRKIRPEGPLFPDGMTVDTDGNIYVATFNGGTVFKVNPSTGKILLEIKI
PTTQITSVAFGGPNLDILYVTTANKFDQPKPAGTTFQVTGLNAKGYAGVN
LKI*

RE17477.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:10:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18129-PA 305 GF18129-PA 2..305 1..303 1283 78 Plus
Dana\GF18130-PA 577 GF18130-PA 274..577 1..303 1259 76.3 Plus
Dana\GF19376-PA 303 GF19376-PA 1..303 1..303 1165 71 Plus
Dana\GF18130-PA 577 GF18130-PA 1..275 1..289 1003 65.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:10:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21077-PA 303 GG21077-PA 1..303 1..303 1512 93.4 Plus
Dere\GG17702-PA 318 GG17702-PA 16..318 1..303 1170 71.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:10:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24165-PA 421 GH24165-PA 119..421 1..303 1144 68.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:28:25
Subject Length Description Subject Range Query Range Score Percent Strand
smp-30-PD 303 CG7390-PD 1..303 1..303 1599 100 Plus
smp-30-PC 306 CG7390-PC 4..306 1..303 1599 100 Plus
smp-30-PB 303 CG7390-PB 1..303 1..303 1599 100 Plus
smp-30-PA 303 CG7390-PA 1..303 1..303 1599 100 Plus
regucalcin-PB 303 CG1803-PB 1..303 1..303 1173 71.9 Plus
regucalcin-PC 303 CG1803-PC 1..303 1..303 1173 71.9 Plus
regucalcin-PA 303 CG1803-PA 1..303 1..303 1173 71.9 Plus
regucalcin-PD 319 CG1803-PD 17..319 1..303 1173 71.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:10:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21765-PA 334 GI21765-PA 32..334 1..303 1168 71 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:10:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23668-PA 303 GL23668-PA 1..303 1..303 1345 82.2 Plus
Dper\GL20270-PA 287 GL20270-PA 23..286 1..302 884 58.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:10:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26692-PA 303 GA26692-PA 1..303 1..303 1345 82.2 Plus
Dpse\GA14770-PA 325 GA14770-PA 23..324 1..302 1167 71.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:10:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25827-PA 303 GM25827-PA 1..303 1..303 1521 94.7 Plus
Dsec\GM13249-PA 315 GM13249-PA 22..315 10..303 1133 71.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:10:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20401-PA 303 GD20401-PA 4..302 1..299 1517 95 Plus
Dsim\GD17058-PA 348 GD17058-PA 46..348 1..303 1171 71.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:10:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18538-PA 303 GJ18538-PA 1..303 1..303 1163 71 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:10:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11687-PA 601 GK11687-PA 1..300 1..300 1228 78 Plus
Dwil\GK10081-PA 303 GK10081-PA 1..303 1..303 1168 69.6 Plus
Dwil\GK11687-PA 601 GK11687-PA 299..601 1..303 1138 70.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:10:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\smp-30-PA 757 GE26429-PA 455..757 1..303 1547 93.1 Plus
Dyak\regucalcin-PA 318 GE16489-PA 16..318 1..303 1166 70.6 Plus