BDGP Sequence Production Resources |
Search the DGRC for RE17611
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 176 |
Well: | 11 |
Vector: | pFlc-1 |
Associated Gene/Transcript | RpL26-RA |
Protein status: | RE17611.pep: gold |
Sequenced Size: | 691 |
Gene | Date | Evidence |
---|---|---|
CG6846 | 2001-12-14 | Blastp of sequenced clone |
CG6846 | 2002-01-01 | Sim4 clustering to Release 2 |
CG6846 | 2003-01-01 | Sim4 clustering to Release 3 |
RpL26 | 2008-04-29 | Release 5.5 accounting |
RpL26 | 2008-08-15 | Release 5.9 accounting |
RpL26 | 2008-12-18 | 5.12 accounting |
691 bp (691 high quality bases) assembled on 2001-12-14
GenBank Submission: AY071133
> RE17611.complete CTCTTTGCCATCCCTAACCGCGACCCATCTGTCAAATTTCTTTCTTTTCG TTGATTTTTCGACGCCCGCACAAGCAAGATGAAACAGAACCCGTTCGTGT CGTCGTCGCGCAGGAAGAACCGCAAGCGTCACTTCCAGGCTCCCTCCCAC ATTCGCAGGCGCCTCATGTCCGCTCCCCTCTCCAAGGAGCTGCGCCAGAA GTACAATGTGCGTTCCATGCCCATCCGCCGCGACGATGAGGTCCAGGTGA TCCGCGGCCACTTCAAGGGCAACCAGGTGGGCAAGGTGGTCCAGGCCTAC CGCAAAAAGTTCGTCGTCTACGTCGAGAAGATCCAGCGCGAGAACGCCAA CGGCACCAACGTCTACGTGGGCATCCATCCCAGCAAGGTGCTGATCGTCA AGCTGAAGCTCGACAAGGACCGCAAGGCCATCCTGGAGCGTCGCGGCAAG GGTCGTCTGGCCGCTCTCGGCAAGGATAAGGGCAAGTACACCGAGGAGAC CGCCGCCCAGCCCATGGAGACCGCGTAAATCGCCGGCTAAAACTCTGCTC TGGACAACTGGGACGTCGCTGTTTACTGTTTTTACGTAACGCTTAGTGTA AAAAACAAAACATCTGAAAAAAATCGCGTGTGAAAACGGCGCCATTCTTT ACAATAAAGGAAAGTTGATTTTCACAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpL26-RA | 1014 | RpL26-RA | 104..782 | 1..678 | 3355 | 99.8 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 18888703..18888766 | 1..64 | 98 | -> | Plus |
chr3L | 18888933..18889544 | 65..675 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL26-RA | 1..450 | 79..528 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL26-RA | 1..450 | 79..528 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL26-RA | 1..450 | 79..528 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL26-RA | 1..450 | 79..528 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL26-RA | 1..450 | 79..528 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL26-RA | 3..678 | 1..675 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL26-RA | 3..678 | 1..675 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL26-RA | 1..648 | 29..675 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL26-RA | 3..678 | 1..675 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL26-RA | 1..648 | 29..675 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 18899076..18899139 | 1..64 | 100 | -> | Plus |
3L | 18899306..18899917 | 65..675 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 18899076..18899139 | 1..64 | 100 | -> | Plus |
3L | 18899306..18899917 | 65..675 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 18899076..18899139 | 1..64 | 100 | -> | Plus |
3L | 18899306..18899917 | 65..675 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 18892176..18892239 | 1..64 | 100 | -> | Plus |
arm_3L | 18892406..18893017 | 65..675 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 18892406..18893017 | 65..675 | 99 | Plus | |
3L | 18892176..18892239 | 1..64 | 100 | -> | Plus |
Translation from 78 to 527
> RE17611.hyp MKQNPFVSSSRRKNRKRHFQAPSHIRRRLMSAPLSKELRQKYNVRSMPIR RDDEVQVIRGHFKGNQVGKVVQAYRKKFVVYVEKIQRENANGTNVYVGIH PSKVLIVKLKLDKDRKAILERRGKGRLAALGKDKGKYTEETAAQPMETA*
Translation from 78 to 527
> RE17611.pep MKQNPFVSSSRRKNRKRHFQAPSHIRRRLMSAPLSKELRQKYNVRSMPIR RDDEVQVIRGHFKGNQVGKVVQAYRKKFVVYVEKIQRENANGTNVYVGIH PSKVLIVKLKLDKDRKAILERRGKGRLAALGKDKGKYTEETAAQPMETA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF23649-PA | 149 | GF23649-PA | 1..149 | 1..149 | 777 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG16013-PA | 149 | GG16013-PA | 1..149 | 1..149 | 771 | 99.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH14601-PA | 150 | GH14601-PA | 1..150 | 1..149 | 736 | 95.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpL26-PB | 149 | CG6846-PB | 1..149 | 1..149 | 756 | 100 | Plus |
RpL26-PC | 149 | CG6846-PC | 1..149 | 1..149 | 756 | 100 | Plus |
RpL26-PA | 149 | CG6846-PA | 1..149 | 1..149 | 756 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI13487-PA | 149 | GI13487-PA | 1..149 | 1..149 | 740 | 96 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA19902-PA | 149 | GA19902-PA | 1..149 | 1..149 | 753 | 96.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM15002-PA | 149 | GM15002-PA | 1..149 | 1..149 | 777 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14780-PA | 149 | GD14780-PA | 1..149 | 1..149 | 777 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ11849-PA | 149 | GJ11849-PA | 1..149 | 1..149 | 740 | 96 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK20452-PA | 149 | GK20452-PA | 1..149 | 1..149 | 760 | 98.7 | Plus |