Clone RE17611 Report

Search the DGRC for RE17611

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:176
Well:11
Vector:pFlc-1
Associated Gene/TranscriptRpL26-RA
Protein status:RE17611.pep: gold
Sequenced Size:691

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6846 2001-12-14 Blastp of sequenced clone
CG6846 2002-01-01 Sim4 clustering to Release 2
CG6846 2003-01-01 Sim4 clustering to Release 3
RpL26 2008-04-29 Release 5.5 accounting
RpL26 2008-08-15 Release 5.9 accounting
RpL26 2008-12-18 5.12 accounting

Clone Sequence Records

RE17611.complete Sequence

691 bp (691 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071133

> RE17611.complete
CTCTTTGCCATCCCTAACCGCGACCCATCTGTCAAATTTCTTTCTTTTCG
TTGATTTTTCGACGCCCGCACAAGCAAGATGAAACAGAACCCGTTCGTGT
CGTCGTCGCGCAGGAAGAACCGCAAGCGTCACTTCCAGGCTCCCTCCCAC
ATTCGCAGGCGCCTCATGTCCGCTCCCCTCTCCAAGGAGCTGCGCCAGAA
GTACAATGTGCGTTCCATGCCCATCCGCCGCGACGATGAGGTCCAGGTGA
TCCGCGGCCACTTCAAGGGCAACCAGGTGGGCAAGGTGGTCCAGGCCTAC
CGCAAAAAGTTCGTCGTCTACGTCGAGAAGATCCAGCGCGAGAACGCCAA
CGGCACCAACGTCTACGTGGGCATCCATCCCAGCAAGGTGCTGATCGTCA
AGCTGAAGCTCGACAAGGACCGCAAGGCCATCCTGGAGCGTCGCGGCAAG
GGTCGTCTGGCCGCTCTCGGCAAGGATAAGGGCAAGTACACCGAGGAGAC
CGCCGCCCAGCCCATGGAGACCGCGTAAATCGCCGGCTAAAACTCTGCTC
TGGACAACTGGGACGTCGCTGTTTACTGTTTTTACGTAACGCTTAGTGTA
AAAAACAAAACATCTGAAAAAAATCGCGTGTGAAAACGGCGCCATTCTTT
ACAATAAAGGAAAGTTGATTTTCACAAAAAAAAAAAAAAAA

RE17611.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:42:00
Subject Length Description Subject Range Query Range Score Percent Strand
RpL26-RA 1014 RpL26-RA 104..782 1..678 3355 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:32:48
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 18888932..18889544 64..675 2985 99.5 Plus
chr3L 24539361 chr3L 18888703..18888766 1..64 305 98.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:38:47 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:32:46
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 18899305..18899920 64..678 3030 99.8 Plus
3L 28110227 3L 18899076..18899139 1..64 320 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:09:01
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 18892405..18893020 64..678 3040 99.8 Plus
3L 28103327 3L 18892176..18892239 1..64 320 100 Plus
Blast to na_te.dros performed on 2019-03-16 22:32:47 has no hits.

RE17611.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:33:45 Download gff for RE17611.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 18888703..18888766 1..64 98 -> Plus
chr3L 18888933..18889544 65..675 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:58:55 Download gff for RE17611.complete
Subject Subject Range Query Range Percent Splice Strand
RpL26-RA 1..450 79..528 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:07:31 Download gff for RE17611.complete
Subject Subject Range Query Range Percent Splice Strand
RpL26-RA 1..450 79..528 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:15:23 Download gff for RE17611.complete
Subject Subject Range Query Range Percent Splice Strand
RpL26-RA 1..450 79..528 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:31:52 Download gff for RE17611.complete
Subject Subject Range Query Range Percent Splice Strand
RpL26-RA 1..450 79..528 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:40:25 Download gff for RE17611.complete
Subject Subject Range Query Range Percent Splice Strand
RpL26-RA 1..450 79..528 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:36:10 Download gff for RE17611.complete
Subject Subject Range Query Range Percent Splice Strand
RpL26-RA 3..678 1..675 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:07:31 Download gff for RE17611.complete
Subject Subject Range Query Range Percent Splice Strand
RpL26-RA 3..678 1..675 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:15:23 Download gff for RE17611.complete
Subject Subject Range Query Range Percent Splice Strand
RpL26-RA 1..648 29..675 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:31:52 Download gff for RE17611.complete
Subject Subject Range Query Range Percent Splice Strand
RpL26-RA 3..678 1..675 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:40:25 Download gff for RE17611.complete
Subject Subject Range Query Range Percent Splice Strand
RpL26-RA 1..648 29..675 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:33:45 Download gff for RE17611.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18899076..18899139 1..64 100 -> Plus
3L 18899306..18899917 65..675 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:33:45 Download gff for RE17611.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18899076..18899139 1..64 100 -> Plus
3L 18899306..18899917 65..675 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:33:45 Download gff for RE17611.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18899076..18899139 1..64 100 -> Plus
3L 18899306..18899917 65..675 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:15:23 Download gff for RE17611.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 18892176..18892239 1..64 100 -> Plus
arm_3L 18892406..18893017 65..675 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:08:36 Download gff for RE17611.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18892406..18893017 65..675 99   Plus
3L 18892176..18892239 1..64 100 -> Plus

RE17611.hyp Sequence

Translation from 78 to 527

> RE17611.hyp
MKQNPFVSSSRRKNRKRHFQAPSHIRRRLMSAPLSKELRQKYNVRSMPIR
RDDEVQVIRGHFKGNQVGKVVQAYRKKFVVYVEKIQRENANGTNVYVGIH
PSKVLIVKLKLDKDRKAILERRGKGRLAALGKDKGKYTEETAAQPMETA*

RE17611.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:18:55
Subject Length Description Subject Range Query Range Score Percent Strand
RpL26-PB 149 CG6846-PB 1..149 1..149 756 100 Plus
RpL26-PA 149 CG6846-PA 1..149 1..149 756 100 Plus

RE17611.pep Sequence

Translation from 78 to 527

> RE17611.pep
MKQNPFVSSSRRKNRKRHFQAPSHIRRRLMSAPLSKELRQKYNVRSMPIR
RDDEVQVIRGHFKGNQVGKVVQAYRKKFVVYVEKIQRENANGTNVYVGIH
PSKVLIVKLKLDKDRKAILERRGKGRLAALGKDKGKYTEETAAQPMETA*

RE17611.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:57:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23649-PA 149 GF23649-PA 1..149 1..149 777 100 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:57:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16013-PA 149 GG16013-PA 1..149 1..149 771 99.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:57:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14601-PA 150 GH14601-PA 1..150 1..149 736 95.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:25:22
Subject Length Description Subject Range Query Range Score Percent Strand
RpL26-PB 149 CG6846-PB 1..149 1..149 756 100 Plus
RpL26-PC 149 CG6846-PC 1..149 1..149 756 100 Plus
RpL26-PA 149 CG6846-PA 1..149 1..149 756 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:57:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13487-PA 149 GI13487-PA 1..149 1..149 740 96 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:57:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19902-PA 149 GA19902-PA 1..149 1..149 753 96.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:57:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15002-PA 149 GM15002-PA 1..149 1..149 777 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:57:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14780-PA 149 GD14780-PA 1..149 1..149 777 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:57:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11849-PA 149 GJ11849-PA 1..149 1..149 740 96 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:57:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20452-PA 149 GK20452-PA 1..149 1..149 760 98.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:57:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19578-PA 149 GE19578-PA 1..149 1..149 777 100 Plus
Dyak\GE19574-PA 149 GE19574-PA 1..149 1..149 777 100 Plus