Clone RE17737 Report

Search the DGRC for RE17737

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:177
Well:37
Vector:pFlc-1
Associated Gene/TranscriptRpL35A-RA
Protein status:RE17737.pep: gold
Sequenced Size:633

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2099 2001-12-14 Blastp of sequenced clone
CG2099 2002-01-01 Sim4 clustering to Release 2
CG2099 2003-01-01 Sim4 clustering to Release 3
RpL35A 2008-04-29 Release 5.5 accounting
RpL35A 2008-08-15 Release 5.9 accounting
RpL35A 2008-12-18 5.12 accounting

Clone Sequence Records

RE17737.complete Sequence

633 bp (633 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071136

> RE17737.complete
TCCTTCTTTTCGCTTTCGTTTCCGGCGAACGGTGTTAATACATTCATCGA
ACAACAAGCTAAGCCATGGCCGACACACAAGCCAAGTCCACTACTGCGCC
CAAGGCCGCCAAGGCCCAGAAGGCTCCCAAGGCCGTCAAGGCGCCTAAGG
CCGAGAAGCCCGCCGCCTCAGAGGCTAAAGTTTCCGCCAAGAAGTACAAG
CGTCACGGACGCCTCTTCGCCAAGGCCGTCTTCACCGGCTACAAGCGTGG
TCTGAGGAACCAGCACGAGAACCAGGCCATCCTCAAGATTGAGGGCGCCC
GCCGCAAGGAGCACGGATCCTTCTACGTTGGGAAGCGTTGCGTCTATGTC
TACAAGGCCGAGACCAAGAAGTGCGTGCCGCAGCATCCCGAGCGCAAGAC
CCGCGTCCGCGCTGTCTGGGGCAAGGTCACCCGCATCCACGGCAACACCG
GCGCTGTGCGTGCCCGTTTCAACAGGAACCTGCCCGGTCATGCCATGGGC
CACCGCATCCGCATCATGCTGTACCCATCAAGGATTTAAGTTAATATCCG
ACTTGAATTACTGACCTGCAGGAGTAAAAAATCCGTTTTACATTAAATGA
AACACTTTAAATTTAATAAAAAAAAAAAAAAAA

RE17737.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:40:53
Subject Length Description Subject Range Query Range Score Percent Strand
RpL35A-RA 907 RpL35A-RA 126..747 1..622 3095 99.8 Plus
RpL35A.a 756 RpL35A.a 9..634 1..622 3030 99.2 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:23:26
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 1291812..1292042 287..57 1155 100 Minus
chr3R 27901430 chr3R 1291459..1291688 515..286 1150 100 Minus
chr3R 27901430 chr3R 1291289..1291390 617..516 510 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:38:52 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:23:24
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5466153..5466383 287..57 1155 100 Minus
3R 32079331 3R 5465800..5466029 515..286 1150 100 Minus
3R 32079331 3R 5465625..5465731 622..516 520 99.1 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:07:55
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 5206984..5207214 287..57 1155 100 Minus
3R 31820162 3R 5206631..5206860 515..286 1150 100 Minus
3R 31820162 3R 5206456..5206562 622..516 520 99 Minus
3R 31820162 3R 5207811..5207839 58..30 145 100 Minus
3R 31820162 3R 5207900..5207928 29..1 145 100 Minus
Blast to na_te.dros performed 2019-03-16 19:23:25
Subject Length Description Subject Range Query Range Score Percent Strand
springer 7546 springer SPRINGER 7546bp Derived from BACR06P08 by Sue Celniker, 29 March 2001. 7106..7141 305..270 108 77.8 Minus

RE17737.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:24:16 Download gff for RE17737.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 1291812..1292040 59..287 100 <- Minus
chr3R 1292639..1292667 30..58 100 <- Minus
chr3R 1292728..1292756 1..29 100   Minus
chr3R 1291289..1291390 516..617 100 <- Minus
chr3R 1291459..1291686 288..515 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:58:58 Download gff for RE17737.complete
Subject Subject Range Query Range Percent Splice Strand
RpL35A-RA 1..474 66..539 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:05:46 Download gff for RE17737.complete
Subject Subject Range Query Range Percent Splice Strand
RpL35A-RA 1..474 66..539 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:38:32 Download gff for RE17737.complete
Subject Subject Range Query Range Percent Splice Strand
RpL35A-RA 1..474 66..539 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:30:21 Download gff for RE17737.complete
Subject Subject Range Query Range Percent Splice Strand
RpL35A-RA 1..474 66..539 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:29:46 Download gff for RE17737.complete
Subject Subject Range Query Range Percent Splice Strand
RpL35A-RA 1..474 66..539 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:33:54 Download gff for RE17737.complete
Subject Subject Range Query Range Percent Splice Strand
RpL35A-RA 1..617 1..617 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:05:46 Download gff for RE17737.complete
Subject Subject Range Query Range Percent Splice Strand
RpL35A-RA 1..617 1..617 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:38:32 Download gff for RE17737.complete
Subject Subject Range Query Range Percent Splice Strand
RpL35A-RA 5..621 1..617 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:30:22 Download gff for RE17737.complete
Subject Subject Range Query Range Percent Splice Strand
RpL35A-RA 1..617 1..617 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:29:46 Download gff for RE17737.complete
Subject Subject Range Query Range Percent Splice Strand
RpL35A-RA 5..621 1..617 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:24:16 Download gff for RE17737.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5465630..5465731 516..617 100 <- Minus
3R 5465800..5466027 288..515 100 <- Minus
3R 5466153..5466381 59..287 100 <- Minus
3R 5466980..5467008 30..58 100 <- Minus
3R 5467069..5467097 1..29 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:24:16 Download gff for RE17737.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5465630..5465731 516..617 100 <- Minus
3R 5465800..5466027 288..515 100 <- Minus
3R 5466153..5466381 59..287 100 <- Minus
3R 5466980..5467008 30..58 100 <- Minus
3R 5467069..5467097 1..29 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:24:16 Download gff for RE17737.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5465630..5465731 516..617 100 <- Minus
3R 5465800..5466027 288..515 100 <- Minus
3R 5466153..5466381 59..287 100 <- Minus
3R 5466980..5467008 30..58 100 <- Minus
3R 5467069..5467097 1..29 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:38:32 Download gff for RE17737.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1291352..1291453 516..617 100 <- Minus
arm_3R 1291522..1291749 288..515 100 <- Minus
arm_3R 1291875..1292103 59..287 100 <- Minus
arm_3R 1292702..1292730 30..58 100 <- Minus
arm_3R 1292791..1292819 1..29 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:06:36 Download gff for RE17737.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5206631..5206858 288..515 100 <- Minus
3R 5206984..5207212 59..287 100 <- Minus
3R 5207811..5207839 30..58 100 <- Minus
3R 5207900..5207928 1..29 100   Minus
3R 5206461..5206562 516..617 100 <- Minus

RE17737.pep Sequence

Translation from 65 to 538

> RE17737.pep
MADTQAKSTTAPKAAKAQKAPKAVKAPKAEKPAASEAKVSAKKYKRHGRL
FAKAVFTGYKRGLRNQHENQAILKIEGARRKEHGSFYVGKRCVYVYKAET
KKCVPQHPERKTRVRAVWGKVTRIHGNTGAVRARFNRNLPGHAMGHRIRI
MLYPSRI*

RE17737.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:43:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17709-PA 172 GF17709-PA 40..172 27..157 667 97 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:43:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11012-PA 157 GG11012-PA 1..157 1..157 798 97.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:43:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18998-PA 163 GH18998-PA 50..163 44..157 598 96.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:24:54
Subject Length Description Subject Range Query Range Score Percent Strand
RpL35A-PA 157 CG2099-PA 1..157 1..157 819 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:43:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24500-PA 159 GI24500-PA 37..159 35..157 627 94.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:43:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22165-PA 159 GL22165-PA 36..159 34..157 641 96.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:43:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15239-PA 159 GA15239-PA 36..159 34..157 641 96.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:43:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10633-PA 157 GM10633-PA 1..157 1..157 797 97.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:43:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19617-PA 157 GD19617-PA 1..157 1..157 800 98.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:43:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24565-PA 159 GJ24565-PA 37..159 35..157 630 95.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:43:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22837-PA 160 GK22837-PA 38..160 35..157 641 95.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:43:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25280-PA 157 GE25280-PA 1..157 1..157 722 95.5 Plus

RE17737.hyp Sequence

Translation from 65 to 538

> RE17737.hyp
MADTQAKSTTAPKAAKAQKAPKAVKAPKAEKPAASEAKVSAKKYKRHGRL
FAKAVFTGYKRGLRNQHENQAILKIEGARRKEHGSFYVGKRCVYVYKAET
KKCVPQHPERKTRVRAVWGKVTRIHGNTGAVRARFNRNLPGHAMGHRIRI
MLYPSRI*

RE17737.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:14:49
Subject Length Description Subject Range Query Range Score Percent Strand
RpL35A-PA 157 CG2099-PA 1..157 1..157 819 100 Plus