Clone RE17991 Report

Search the DGRC for RE17991

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:179
Well:91
Vector:pFlc-1
Associated Gene/TranscriptRpL27A-RA
Protein status:RE17991.pep: gold
Preliminary Size:965
Sequenced Size:649

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15442 2001-12-14 Blastp of sequenced clone
CG15442 2002-01-01 Sim4 clustering to Release 2
CG15442 2003-01-01 Sim4 clustering to Release 3
RpL27A 2008-04-29 Release 5.5 accounting
RpL27A 2008-08-15 Release 5.9 accounting
RpL27A 2008-12-18 5.12 accounting

Clone Sequence Records

RE17991.complete Sequence

649 bp (649 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071144

> RE17991.complete
GTTATCGCCGCCGGGCGGTCACACTGCTACAACCGCAGCCAACTTCGCTT
CTTTCTTTCCTACAATTTTAAAGATGTCGAATATCAAGCGGAAGAAGACC
AGGAAGCTGCGTGGTCATGTGAGCCACGGTCACGGCCGTATCGGCAAGCA
CCGCAAGCATCCCGGAGGTCGCGGTAACGCTGGTGGCATGCACCATCACC
GCATCAACTTCGACAAATACCATCCTGGTTACTTCGGCAAGGTGGGCATG
AGGAACTTCCATCTGCGTCGCCAGCACAAGTTCAGGCCCGAGATCAACCT
GGACAAGCTCTGGTCCCTGGTCGGAGCCGAGAAGTTCGCCGAGCTGGAGA
AGGAGAAGAGCACCAAGGCTCCCGTCATCGACTTGGTTAAATTCGGCTAC
TACAAGCTGCTGGGCCGTGGTCACCTGCCCGCCCGCCCCGTCATCGTGAA
GGCCAAGTACTTCTCTAAGAAGGCTGAGGACAAGATCAAGAAGGCCGGCG
GTGTGTGCTTGCTGAGCGCCTAAGTTAAGATTCCTCCTCTACAGAAGAAA
AAAGCAAGTGGACTACATTCGACCATCAAAAATGTATTTGTTTTTTAATA
AATTTAAAAGAAAAACAAGTATTTGCTATTCCGAAAAAAAAAAAAAAAA

RE17991.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:45:51
Subject Length Description Subject Range Query Range Score Percent Strand
RpL27A-RA 707 RpL27A-RA 26..664 1..639 3180 99.8 Plus
RpL27A.c 666 RpL27A.c 99..662 76..639 2805 99.8 Plus
RpL27A.e 681 RpL27A.e 10..538 1..529 2645 100 Plus
RpL27A.e 681 RpL27A.e 566..677 528..639 545 99.1 Plus
RpL27A.c 666 RpL27A.c 10..85 1..76 380 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:59:25
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 4456872..4457191 395..76 1600 100 Minus
chr2L 23010047 chr2L 4456508..4456642 529..395 675 100 Minus
chr2L 23010047 chr2L 4456319..4456424 633..528 530 100 Minus
chr2L 23010047 chr2L 4457422..4457497 76..1 380 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:39:07 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:59:23
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4457739..4458058 395..76 1600 100 Minus
2L 23513712 2L 4457375..4457509 529..395 675 100 Minus
2L 23513712 2L 4457180..4457291 639..528 545 99.1 Minus
2L 23513712 2L 4458289..4458364 76..1 380 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:12:22
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4457739..4458058 395..76 1600 100 Minus
2L 23513712 2L 4457375..4457509 529..395 675 100 Minus
2L 23513712 2L 4457180..4457291 639..528 545 99.1 Minus
2L 23513712 2L 4458289..4458364 76..1 380 100 Minus
Blast to na_te.dros performed on 2019-03-16 11:59:24 has no hits.

RE17991.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:00:33 Download gff for RE17991.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 4456319..4456422 530..633 100 <- Minus
chr2L 4456508..4456642 395..529 100 <- Minus
chr2L 4456873..4457190 77..394 100 <- Minus
chr2L 4457422..4457497 1..76 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:59:14 Download gff for RE17991.complete
Subject Subject Range Query Range Percent Splice Strand
RpL27A-RA 1..450 74..523 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:13:02 Download gff for RE17991.complete
Subject Subject Range Query Range Percent Splice Strand
RpL27A-RA 1..450 74..523 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:42:35 Download gff for RE17991.complete
Subject Subject Range Query Range Percent Splice Strand
RpL27A-RC 1..450 74..523 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:37:11 Download gff for RE17991.complete
Subject Subject Range Query Range Percent Splice Strand
RpL27A-RA 1..450 74..523 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:32:43 Download gff for RE17991.complete
Subject Subject Range Query Range Percent Splice Strand
RpL27A-RC 1..450 74..523 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:44:08 Download gff for RE17991.complete
Subject Subject Range Query Range Percent Splice Strand
RpL27A-RA 1..633 1..633 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:13:02 Download gff for RE17991.complete
Subject Subject Range Query Range Percent Splice Strand
RpL27A-RA 10..642 1..633 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:42:35 Download gff for RE17991.complete
Subject Subject Range Query Range Percent Splice Strand
RpL27A-RC 1..633 1..633 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:37:11 Download gff for RE17991.complete
Subject Subject Range Query Range Percent Splice Strand
RpL27A-RA 1..633 1..633 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:32:43 Download gff for RE17991.complete
Subject Subject Range Query Range Percent Splice Strand
RpL27A-RC 1..633 1..633 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:00:33 Download gff for RE17991.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4457740..4458057 77..394 100 <- Minus
2L 4458289..4458364 1..76 100   Minus
2L 4457186..4457289 530..633 100 <- Minus
2L 4457375..4457509 395..529 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:00:33 Download gff for RE17991.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4457740..4458057 77..394 100 <- Minus
2L 4458289..4458364 1..76 100   Minus
2L 4457186..4457289 530..633 100 <- Minus
2L 4457375..4457509 395..529 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:00:33 Download gff for RE17991.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4457740..4458057 77..394 100 <- Minus
2L 4458289..4458364 1..76 100   Minus
2L 4457186..4457289 530..633 100 <- Minus
2L 4457375..4457509 395..529 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:42:35 Download gff for RE17991.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 4457186..4457289 530..633 100 <- Minus
arm_2L 4457375..4457509 395..529 100 <- Minus
arm_2L 4457740..4458057 77..394 100 <- Minus
arm_2L 4458289..4458364 1..76 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:14:47 Download gff for RE17991.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4457740..4458057 77..394 100 <- Minus
2L 4458289..4458364 1..76 100   Minus
2L 4457186..4457289 530..633 100 <- Minus
2L 4457375..4457509 395..529 100 <- Minus

RE17991.hyp Sequence

Translation from 0 to 522

> RE17991.hyp
LSPPGGHTATTAANFASFFPTILKMSNIKRKKTRKLRGHVSHGHGRIGKH
RKHPGGRGNAGGMHHHRINFDKYHPGYFGKVGMRNFHLRRQHKFRPEINL
DKLWSLVGAEKFAELEKEKSTKAPVIDLVKFGYYKLLGRGHLPARPVIVK
AKYFSKKAEDKIKKAGGVCLLSA*

RE17991.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:10:26
Subject Length Description Subject Range Query Range Score Percent Strand
RpL27A-PD 149 CG15442-PD 1..149 25..173 805 100 Plus
RpL27A-PA 149 CG15442-PA 1..149 25..173 805 100 Plus
RpL27A-PC 149 CG15442-PC 1..149 25..173 805 100 Plus

RE17991.pep Sequence

Translation from 73 to 522

> RE17991.pep
MSNIKRKKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGMHHHRINFDKYH
PGYFGKVGMRNFHLRRQHKFRPEINLDKLWSLVGAEKFAELEKEKSTKAP
VIDLVKFGYYKLLGRGHLPARPVIVKAKYFSKKAEDKIKKAGGVCLLSA*

RE17991.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:21:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24011-PA 149 GF24011-PA 1..149 1..149 766 100 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:21:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24372-PA 149 GG24372-PA 1..149 1..149 766 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:21:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11657-PA 149 GH11657-PA 1..149 1..149 761 98 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:39:32
Subject Length Description Subject Range Query Range Score Percent Strand
RpL27A-PD 149 CG15442-PD 1..149 1..149 805 100 Plus
RpL27A-PC 149 CG15442-PC 1..149 1..149 805 100 Plus
RpL27A-PA 149 CG15442-PA 1..149 1..149 805 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:21:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17959-PA 149 GI17959-PA 1..149 1..149 759 98.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:21:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15400-PA 149 GL15400-PA 1..149 1..149 761 99.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:21:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13733-PA 149 GA13733-PA 1..149 1..149 756 98.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:21:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18088-PA 149 GM18088-PA 1..149 1..149 766 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:21:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22706-PA 149 GD22706-PA 1..149 1..149 766 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:21:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17732-PA 149 GJ17732-PA 1..149 1..149 759 98.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:21:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24354-PA 149 GK24354-PA 1..149 1..149 752 98 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:21:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\RpL27A-PA 149 GE14714-PA 1..149 1..149 766 100 Plus