BDGP Sequence Production Resources |
Search the DGRC for RE17991
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 179 |
Well: | 91 |
Vector: | pFlc-1 |
Associated Gene/Transcript | RpL27A-RA |
Protein status: | RE17991.pep: gold |
Preliminary Size: | 965 |
Sequenced Size: | 649 |
Gene | Date | Evidence |
---|---|---|
CG15442 | 2001-12-14 | Blastp of sequenced clone |
CG15442 | 2002-01-01 | Sim4 clustering to Release 2 |
CG15442 | 2003-01-01 | Sim4 clustering to Release 3 |
RpL27A | 2008-04-29 | Release 5.5 accounting |
RpL27A | 2008-08-15 | Release 5.9 accounting |
RpL27A | 2008-12-18 | 5.12 accounting |
649 bp (649 high quality bases) assembled on 2001-12-14
GenBank Submission: AY071144
> RE17991.complete GTTATCGCCGCCGGGCGGTCACACTGCTACAACCGCAGCCAACTTCGCTT CTTTCTTTCCTACAATTTTAAAGATGTCGAATATCAAGCGGAAGAAGACC AGGAAGCTGCGTGGTCATGTGAGCCACGGTCACGGCCGTATCGGCAAGCA CCGCAAGCATCCCGGAGGTCGCGGTAACGCTGGTGGCATGCACCATCACC GCATCAACTTCGACAAATACCATCCTGGTTACTTCGGCAAGGTGGGCATG AGGAACTTCCATCTGCGTCGCCAGCACAAGTTCAGGCCCGAGATCAACCT GGACAAGCTCTGGTCCCTGGTCGGAGCCGAGAAGTTCGCCGAGCTGGAGA AGGAGAAGAGCACCAAGGCTCCCGTCATCGACTTGGTTAAATTCGGCTAC TACAAGCTGCTGGGCCGTGGTCACCTGCCCGCCCGCCCCGTCATCGTGAA GGCCAAGTACTTCTCTAAGAAGGCTGAGGACAAGATCAAGAAGGCCGGCG GTGTGTGCTTGCTGAGCGCCTAAGTTAAGATTCCTCCTCTACAGAAGAAA AAAGCAAGTGGACTACATTCGACCATCAAAAATGTATTTGTTTTTTAATA AATTTAAAAGAAAAACAAGTATTTGCTATTCCGAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpL27A-RA | 707 | RpL27A-RA | 26..664 | 1..639 | 3180 | 99.8 | Plus |
RpL27A.c | 666 | RpL27A.c | 99..662 | 76..639 | 2805 | 99.8 | Plus |
RpL27A.e | 681 | RpL27A.e | 10..538 | 1..529 | 2645 | 100 | Plus |
RpL27A.e | 681 | RpL27A.e | 566..677 | 528..639 | 545 | 99.1 | Plus |
RpL27A.c | 666 | RpL27A.c | 10..85 | 1..76 | 380 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 4456872..4457191 | 395..76 | 1600 | 100 | Minus |
chr2L | 23010047 | chr2L | 4456508..4456642 | 529..395 | 675 | 100 | Minus |
chr2L | 23010047 | chr2L | 4456319..4456424 | 633..528 | 530 | 100 | Minus |
chr2L | 23010047 | chr2L | 4457422..4457497 | 76..1 | 380 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 4457739..4458058 | 395..76 | 1600 | 100 | Minus |
2L | 23513712 | 2L | 4457375..4457509 | 529..395 | 675 | 100 | Minus |
2L | 23513712 | 2L | 4457180..4457291 | 639..528 | 545 | 99.1 | Minus |
2L | 23513712 | 2L | 4458289..4458364 | 76..1 | 380 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 4457739..4458058 | 395..76 | 1600 | 100 | Minus |
2L | 23513712 | 2L | 4457375..4457509 | 529..395 | 675 | 100 | Minus |
2L | 23513712 | 2L | 4457180..4457291 | 639..528 | 545 | 99.1 | Minus |
2L | 23513712 | 2L | 4458289..4458364 | 76..1 | 380 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 4456319..4456422 | 530..633 | 100 | <- | Minus |
chr2L | 4456508..4456642 | 395..529 | 100 | <- | Minus |
chr2L | 4456873..4457190 | 77..394 | 100 | <- | Minus |
chr2L | 4457422..4457497 | 1..76 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL27A-RA | 1..450 | 74..523 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL27A-RA | 1..450 | 74..523 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL27A-RC | 1..450 | 74..523 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL27A-RA | 1..450 | 74..523 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL27A-RC | 1..450 | 74..523 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL27A-RA | 1..633 | 1..633 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL27A-RA | 10..642 | 1..633 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL27A-RC | 1..633 | 1..633 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL27A-RA | 1..633 | 1..633 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL27A-RC | 1..633 | 1..633 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 4457740..4458057 | 77..394 | 100 | <- | Minus |
2L | 4458289..4458364 | 1..76 | 100 | Minus | |
2L | 4457186..4457289 | 530..633 | 100 | <- | Minus |
2L | 4457375..4457509 | 395..529 | 100 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 4457740..4458057 | 77..394 | 100 | <- | Minus |
2L | 4458289..4458364 | 1..76 | 100 | Minus | |
2L | 4457186..4457289 | 530..633 | 100 | <- | Minus |
2L | 4457375..4457509 | 395..529 | 100 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 4457740..4458057 | 77..394 | 100 | <- | Minus |
2L | 4458289..4458364 | 1..76 | 100 | Minus | |
2L | 4457186..4457289 | 530..633 | 100 | <- | Minus |
2L | 4457375..4457509 | 395..529 | 100 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 4457186..4457289 | 530..633 | 100 | <- | Minus |
arm_2L | 4457375..4457509 | 395..529 | 100 | <- | Minus |
arm_2L | 4457740..4458057 | 77..394 | 100 | <- | Minus |
arm_2L | 4458289..4458364 | 1..76 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 4457740..4458057 | 77..394 | 100 | <- | Minus |
2L | 4458289..4458364 | 1..76 | 100 | Minus | |
2L | 4457186..4457289 | 530..633 | 100 | <- | Minus |
2L | 4457375..4457509 | 395..529 | 100 | <- | Minus |
Translation from 0 to 522
> RE17991.hyp LSPPGGHTATTAANFASFFPTILKMSNIKRKKTRKLRGHVSHGHGRIGKH RKHPGGRGNAGGMHHHRINFDKYHPGYFGKVGMRNFHLRRQHKFRPEINL DKLWSLVGAEKFAELEKEKSTKAPVIDLVKFGYYKLLGRGHLPARPVIVK AKYFSKKAEDKIKKAGGVCLLSA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpL27A-PD | 149 | CG15442-PD | 1..149 | 25..173 | 805 | 100 | Plus |
RpL27A-PA | 149 | CG15442-PA | 1..149 | 25..173 | 805 | 100 | Plus |
RpL27A-PC | 149 | CG15442-PC | 1..149 | 25..173 | 805 | 100 | Plus |
Translation from 73 to 522
> RE17991.pep MSNIKRKKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGMHHHRINFDKYH PGYFGKVGMRNFHLRRQHKFRPEINLDKLWSLVGAEKFAELEKEKSTKAP VIDLVKFGYYKLLGRGHLPARPVIVKAKYFSKKAEDKIKKAGGVCLLSA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24011-PA | 149 | GF24011-PA | 1..149 | 1..149 | 766 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG24372-PA | 149 | GG24372-PA | 1..149 | 1..149 | 766 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH11657-PA | 149 | GH11657-PA | 1..149 | 1..149 | 761 | 98 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpL27A-PD | 149 | CG15442-PD | 1..149 | 1..149 | 805 | 100 | Plus |
RpL27A-PC | 149 | CG15442-PC | 1..149 | 1..149 | 805 | 100 | Plus |
RpL27A-PA | 149 | CG15442-PA | 1..149 | 1..149 | 805 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI17959-PA | 149 | GI17959-PA | 1..149 | 1..149 | 759 | 98.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL15400-PA | 149 | GL15400-PA | 1..149 | 1..149 | 761 | 99.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA13733-PA | 149 | GA13733-PA | 1..149 | 1..149 | 756 | 98.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM18088-PA | 149 | GM18088-PA | 1..149 | 1..149 | 766 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD22706-PA | 149 | GD22706-PA | 1..149 | 1..149 | 766 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ17732-PA | 149 | GJ17732-PA | 1..149 | 1..149 | 759 | 98.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK24354-PA | 149 | GK24354-PA | 1..149 | 1..149 | 752 | 98 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\RpL27A-PA | 149 | GE14714-PA | 1..149 | 1..149 | 766 | 100 | Plus |