Clone RE18415 Report

Search the DGRC for RE18415

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:184
Well:15
Vector:pFlc-1
Associated Gene/TranscriptCG5516-RA
Protein status:RE18415.pep: gold
Preliminary Size:531
Sequenced Size:825

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5516 2001-12-14 Blastp of sequenced clone
CG5516 2002-01-01 Sim4 clustering to Release 2
CG5516 2003-01-01 Sim4 clustering to Release 3
CG5516 2008-04-29 Release 5.5 accounting
CG5516 2008-08-15 Release 5.9 accounting
CG5516 2008-12-18 5.12 accounting

Clone Sequence Records

RE18415.complete Sequence

825 bp (825 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071154

> RE18415.complete
GATTAGCGAAGTATACAATTTTCAGTGGACTATCGCTAATGTGACGAAAA
AAATTATAAAAAACATTTTTGATACTCATTTTTCCCAGTTTTTCCACCCG
GCCACGTTGGTTTCCACCCACATCAAGATTTCCTCCCAACAGCGTCTGCT
CGAGTGCTTCAGGATGACTTTGGTGGGCCTAGCTGCCCGCAAATTAGCGC
AAAAGAAGAGATCCGCAAAGCAAGCAGCAGACTTTCCCAATGGCATCCGG
TGCCAGAAGTGCCTGCAGATCGGACACTGGAGCTATGAGTGCAAGGAGAA
GCGCAAATACGTCCACCGGAGCTCGCGTACCAAGCAGCTAAGCAAGCGTA
TGTCCCAAAAGGAGGCTGACGCACCCAAGAACCAGGTGGAGGAGCACTCG
GAAGTGGCTTCCTCGGAAGGAAAGAAGGTCCGTCGAAAGCGGAAAACGAG
CAAGAGCTCCTCGTCCTCCTCCAGCTCGTCGGACAGCTCAGACAGCAGCA
GCGAATCGGGCTCCTCATCCGAATCAGACTCGAGCAGCTCCAGTTCGGAT
TCGGACGACGAGGAAGGCAGCTCGTCAGACTCCAGTGGAAGTGGCTCGGA
CAGCGACAGCAGCGAGGATCAAAAGCAGGGAGCTCCACAAAAAAAGAAAA
AACGAGCCGGGAGTTCACCTGAATCTTCTGACGATCAAGAGTAATCAAGA
GACCGATTTGTGGTCTGTAGTATGTAGCTTTACTAGTTTAGTTTTCCCAC
ACTTACACCGAAAATGAACATACTTTTGGTACTGTATTGTTTATATTTTA
ATGCTCCCGAAAAAAAAAAAAAAAA

RE18415.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:07:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG5516-RA 904 CG5516-RA 1..808 1..808 4025 99.8 Plus
CG5516.a 751 CG5516.a 32..751 89..808 3600 100 Plus
CG32856-RA 650 CG32856-RA 566..650 808..724 425 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:59:33
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 11788761..11789360 209..808 3000 100 Plus
chr3R 27901430 chr3R 11788486..11788695 1..210 1035 99.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:39:30 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:59:31
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15964163..15964762 209..808 3000 100 Plus
3R 32079331 3R 15963888..15964097 1..210 1035 99.5 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:38:54
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 15704994..15705593 209..808 3000 100 Plus
3R 31820162 3R 15704719..15704928 1..210 1035 99.5 Plus
Blast to na_te.dros performed on 2019-03-16 11:59:31 has no hits.

RE18415.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:00:37 Download gff for RE18415.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 11788486..11788695 1..210 99 -> Plus
chr3R 11788763..11789360 211..809 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:59:38 Download gff for RE18415.complete
Subject Subject Range Query Range Percent Splice Strand
CG5516-RA 1..531 164..694 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:51:10 Download gff for RE18415.complete
Subject Subject Range Query Range Percent Splice Strand
CG5516-RB 1..531 164..694 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:43:47 Download gff for RE18415.complete
Subject Subject Range Query Range Percent Splice Strand
CG5516-RA 1..531 164..694 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:43:48 Download gff for RE18415.complete
Subject Subject Range Query Range Percent Splice Strand
CG5516-RA 1..531 164..694 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:32:51 Download gff for RE18415.complete
Subject Subject Range Query Range Percent Splice Strand
CG5516-RA 1..531 164..694 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:28:52 Download gff for RE18415.complete
Subject Subject Range Query Range Percent Splice Strand
CG5516-RA 1..803 1..803 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:51:10 Download gff for RE18415.complete
Subject Subject Range Query Range Percent Splice Strand
CG5516-RA 7..813 1..807 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:43:47 Download gff for RE18415.complete
Subject Subject Range Query Range Percent Splice Strand
CG5516-RA 7..813 1..807 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:43:48 Download gff for RE18415.complete
Subject Subject Range Query Range Percent Splice Strand
CG5516-RA 1..803 1..803 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:32:51 Download gff for RE18415.complete
Subject Subject Range Query Range Percent Splice Strand
CG5516-RA 5..811 1..807 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:00:37 Download gff for RE18415.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15963888..15964097 1..210 99 -> Plus
3R 15964165..15964762 211..809 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:00:37 Download gff for RE18415.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15963888..15964097 1..210 99 -> Plus
3R 15964165..15964762 211..809 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:00:37 Download gff for RE18415.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15963888..15964097 1..210 99 -> Plus
3R 15964165..15964762 211..809 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:43:47 Download gff for RE18415.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11789610..11789819 1..210 99 -> Plus
arm_3R 11789887..11790484 211..809 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:16:05 Download gff for RE18415.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15704719..15704928 1..210 99 -> Plus
3R 15704996..15705593 211..809 99   Plus

RE18415.hyp Sequence

Translation from 0 to 693

> RE18415.hyp
ICEVYNFQWTIANVTKKIIKNIFDTHFSQFFHPATLVSTHIKISSQQRLL
ECFRMTLVGLAARKLAQKKRSAKQAADFPNGIRCQKCLQIGHWSYECKEK
RKYVHRSSRTKQLSKRMSQKEADAPKNQVEEHSEVASSEGKKVRRKRKTS
KSSSSSSSSSDSSDSSSESGSSSESDSSSSSSDSDDEEGSSSDSSGSGSD
SDSSEDQKQGAPQKKKKRAGSSPESSDDQE*

RE18415.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:19:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG5516-PB 176 CG5516-PB 1..176 55..230 873 100 Plus
CG5516-PA 176 CG5516-PA 1..176 55..230 873 100 Plus
CG3918-PA 321 CG3918-PA 145..281 98..228 179 36 Plus
PNUTS-PA 628 CG33526-PA 282..415 105..226 161 36.5 Plus
PNUTS-PB 628 CG33526-PB 282..415 105..226 161 36.5 Plus
PNUTS-PA 628 CG33526-PA 327..448 106..226 157 36.6 Plus
PNUTS-PA 628 CG33526-PA 279..392 114..226 154 37.7 Plus
PNUTS-PA 628 CG33526-PA 281..422 98..230 152 31.7 Plus

RE18415.pep Sequence

Translation from 163 to 693

> RE18415.pep
MTLVGLAARKLAQKKRSAKQAADFPNGIRCQKCLQIGHWSYECKEKRKYV
HRSSRTKQLSKRMSQKEADAPKNQVEEHSEVASSEGKKVRRKRKTSKSSS
SSSSSSDSSDSSSESGSSSESDSSSSSSDSDDEEGSSSDSSGSGSDSDSS
EDQKQGAPQKKKKRAGSSPESSDDQE*

RE18415.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:07:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG5516-PB 176 CG5516-PB 1..176 1..176 873 100 Plus
CG5516-PA 176 CG5516-PA 1..176 1..176 873 100 Plus
CG3918-PA 321 CG3918-PA 145..281 44..174 179 36 Plus
PNUTS-PA 628 CG33526-PA 282..415 51..172 161 36.5 Plus
PNUTS-PB 628 CG33526-PB 282..415 51..172 161 36.5 Plus
CG5808-PA 653 CG5808-PA 521..646 44..172 161 36.2 Plus
PNUTS-PE 1135 CG33526-PE 282..415 51..172 161 36.5 Plus
PNUTS-PD 1135 CG33526-PD 282..415 51..172 161 36.5 Plus
PNUTS-PA 628 CG33526-PA 327..448 52..172 157 36.6 Plus
PNUTS-PB 628 CG33526-PB 327..448 52..172 157 36.6 Plus
PNUTS-PE 1135 CG33526-PE 327..448 52..172 157 36.6 Plus
PNUTS-PD 1135 CG33526-PD 327..448 52..172 157 36.6 Plus
CG6066-PA 463 CG6066-PA 206..318 59..172 157 36.8 Plus
RnpS1-PA 374 CG16788-PA 12..117 65..171 156 43.6 Plus
PNUTS-PA 628 CG33526-PA 279..392 60..172 154 37.7 Plus
PNUTS-PB 628 CG33526-PB 279..392 60..172 154 37.7 Plus
PNUTS-PE 1135 CG33526-PE 279..392 60..172 154 37.7 Plus
PNUTS-PD 1135 CG33526-PD 279..392 60..172 154 37.7 Plus
PNUTS-PA 628 CG33526-PA 281..422 44..176 152 31.7 Plus
PNUTS-PB 628 CG33526-PB 281..422 44..176 152 31.7 Plus
PNUTS-PE 1135 CG33526-PE 281..422 44..176 152 31.7 Plus
PNUTS-PD 1135 CG33526-PD 281..422 44..176 152 31.7 Plus
Mur89F-PC 2158 CG4090-PC 599..721 53..173 151 33.1 Plus
Mur89F-PB 2159 CG4090-PB 599..721 53..173 151 33.1 Plus
BOD1-PC 1109 CG5514-PC 598..723 44..172 148 32.6 Plus
BOD1-PA 1109 CG5514-PA 598..723 44..172 148 32.6 Plus
BOD1-PD 1150 CG5514-PD 598..723 44..172 148 32.6 Plus
BOD1-PB 1150 CG5514-PB 598..723 44..172 148 32.6 Plus
BOD1-PE 1151 CG5514-PE 598..723 44..172 148 32.6 Plus
CG12877-PC 991 CG12877-PC 197..333 44..176 147 34.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 23:33:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18942-PA 181 GA18942-PA 1..73 1..74 335 82.4 Plus