Clone RE18604 Report

Search the DGRC for RE18604

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:186
Well:4
Vector:pFlc-1
Associated Gene/TranscriptCG5174-RH
Protein status:RE18604.pep: gold
Preliminary Size:5146
Sequenced Size:1484

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5174 2002-10-09 Blastp of sequenced clone
CG5174 2003-01-01 Sim4 clustering to Release 3
CG5174 2008-04-29 Release 5.5 accounting
CG5174 2008-08-15 Release 5.9 accounting
CG5174 2008-12-18 5.12 accounting

Clone Sequence Records

RE18604.complete Sequence

1484 bp (1484 high quality bases) assembled on 2002-10-09

GenBank Submission: BT001567

> RE18604.complete
AGCAACCATCGATAGCTAAGCAAGCGAAACAAAAAATTATTTTCAACTTG
AAAGTTTTGCGACAAGTGCGTGCAGTTGGCATCGAAATAGTTAACAAAAT
TGCCGCAGACTTCCGGAGACAACGCCGTAATGGAGGACCATAATACAGCC
AACCTGTCGGAGCCAGCATCTCCAGCTAATTCTGTGGCATCCGCAGAAAT
TGCCGCCGAGTTCGCTGCGCTTTCCGTCGAGGAGAAGGAGCAGCGTCGGG
CTGAGTGGAGTCAGGAGCTCGCCCGCGTTGAGGAAGAGATCAATACGCTG
CGAACTGTCCTAGCCTCCAAGACGCGCCATGCCTCCGATCTCAAGCGCAA
GCTGGGCATCACCGTCTGGAAGGAGGTGACGGACGACGTGAACCAGGGCC
TTAAGAACCTCAAGGAGAGCACTGTATACCAACGCACTGAGTCGGTGCTA
AAGTCCACGGGCGAGAAGACCGCCTCGGTGTTTGGCAGCATCACCAGTGG
CATTTCGTCGAAACTGTCGCAAATGAAAAACTCCGAATCGATGCGTTCTA
TCGAGGCTTCGGTGGGCTCTGCCTACGAGAACGTTAAAACCAAGGTGACA
TCCCGCTCGGGTTCGGTGTCCAGTTTCCCAGATGCCCTGGACGAGAATAA
CACATCCTCGGGTCTGAATTCACCCACAGACTCACTCCCGAAATAGATTT
CGGGGCAACTGCAAGGCCAAGCGCGTCGATAATGTGGAGCAACCTATACT
ACATACAAACAGACCCACGCACCCACTCTATTAACTTATTTAACTAAAGC
GAATTGTCGTGTCTGCGCACTAACAACAGGATCAGAATTAATTTAACCAG
AAATCATATGTACACCTGTGTCGATACGGTTTATATAATACTTAATATAA
CTAAAATCTGCGCGTCAAAAATTTGCCAATGGGAGCACATATTATATGCA
TCTATTTGTATTTGCCTTGGAGACACCATCAAATTGCATGACTTGTTTAA
ATTTAAAGCCACGGAGGATCGAAGATCCAAGGGCTTGCTGCATTCGTTTA
TATAACTATCAATCTAAGTGTACGTTTAAAGACTAAACCACATTGGATGG
TCCACCCGATGTCATTCCCAAATGTTTCTAATACTTAGTAAAAACATTAG
AAAATCATGCATTGCGGTTAAAGTGAATATACATTTGTTTTACGCTTTTA
TTTCTTCTCTAGGCGTTGAGTTCCGTGGTTAGATGGCGTTCCCTAATCCG
TTGAAAAGCCAATTCCAAATTTATTTAGTACTAAATATTTGTGTTACGAT
CAGAGCTTGCGTGCAAATAACGAAAATCCATTGGTAAACTTAAGTGGATG
TAGTCCGTACTGCTGAAGATTGAGAAAGAGACGAAATCGCACCCAATTTG
TTGCTAATGCTGATCAAATTTGCTATATGTGTATGAAATCTTTGAATAAA
TGCAAAAATTTTTGCCCCAAAAAAAAAAAAAAAA

RE18604.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:40:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG5174-RH 1611 CG5174-RH 134..1608 1..1475 7360 99.9 Plus
CG5174-RA 1654 CG5174-RA 601..1651 425..1475 5240 99.9 Plus
CG5174.b 1696 CG5174.b 807..1693 589..1475 4420 99.8 Plus
CG5174-RA 1654 CG5174-RA 117..548 1..432 2145 99.7 Plus
CG5174.b 1696 CG5174.b 117..548 1..432 2145 99.7 Plus
CG5174.b 1696 CG5174.b 601..764 425..588 820 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:24:55
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 14312391..14313271 589..1468 4355 99.9 Plus
chr2R 21145070 chr2R 14311374..14311537 262..425 820 100 Plus
chr2R 21145070 chr2R 14311923..14312085 426..588 815 100 Plus
chr2R 21145070 chr2R 14308466..14308608 1..143 670 97.9 Plus
chr2R 21145070 chr2R 14311178..14311303 140..265 630 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:39:37 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:24:53
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18425340..18426226 589..1475 4420 99.9 Plus
2R 25286936 2R 18424323..18424486 262..425 820 100 Plus
2R 25286936 2R 18424872..18425034 426..588 815 100 Plus
2R 25286936 2R 18421415..18421557 1..143 700 99.3 Plus
2R 25286936 2R 18424127..18424252 140..265 630 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:13:44
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 18426539..18427425 589..1475 4420 99.8 Plus
2R 25260384 2R 18425522..18425685 262..425 820 100 Plus
2R 25260384 2R 18426071..18426233 426..588 815 100 Plus
2R 25260384 2R 18422614..18422756 1..143 700 99.3 Plus
2R 25260384 2R 18425326..18425451 140..265 630 100 Plus
Blast to na_te.dros performed on 2019-03-16 19:24:54 has no hits.

RE18604.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:25:57 Download gff for RE18604.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 14311377..14311537 265..425 100 -> Plus
chr2R 14311923..14312085 426..588 100 -> Plus
chr2R 14308466..14308604 1..139 98 -> Plus
chr2R 14311178..14311302 140..264 100 -> Plus
chr2R 14312391..14313271 589..1468 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:59:47 Download gff for RE18604.complete
Subject Subject Range Query Range Percent Splice Strand
CG5174-RH 1..567 130..696 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:12:34 Download gff for RE18604.complete
Subject Subject Range Query Range Percent Splice Strand
CG5174-RH 1..567 130..696 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:39:15 Download gff for RE18604.complete
Subject Subject Range Query Range Percent Splice Strand
CG5174-RH 1..567 130..696 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:03:27 Download gff for RE18604.complete
Subject Subject Range Query Range Percent Splice Strand
CG5174-RH 1..567 130..696 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:30:42 Download gff for RE18604.complete
Subject Subject Range Query Range Percent Splice Strand
CG5174-RH 1..567 130..696 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:34:53 Download gff for RE18604.complete
Subject Subject Range Query Range Percent Splice Strand
CG5174-RH 6..1473 1..1468 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:12:34 Download gff for RE18604.complete
Subject Subject Range Query Range Percent Splice Strand
CG5174-RH 6..1473 1..1468 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:39:15 Download gff for RE18604.complete
Subject Subject Range Query Range Percent Splice Strand
CG5174-RH 3..1470 1..1468 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:03:27 Download gff for RE18604.complete
Subject Subject Range Query Range Percent Splice Strand
CG5174-RH 6..1473 1..1468 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:30:42 Download gff for RE18604.complete
Subject Subject Range Query Range Percent Splice Strand
CG5174-RH 3..1470 1..1468 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:25:57 Download gff for RE18604.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18421415..18421553 1..139 100 -> Plus
2R 18424127..18424251 140..264 100 -> Plus
2R 18424326..18424486 265..425 100 -> Plus
2R 18424872..18425034 426..588 100 -> Plus
2R 18425340..18426219 589..1468 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:25:57 Download gff for RE18604.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18421415..18421553 1..139 100 -> Plus
2R 18424127..18424251 140..264 100 -> Plus
2R 18424326..18424486 265..425 100 -> Plus
2R 18424872..18425034 426..588 100 -> Plus
2R 18425340..18426219 589..1468 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:25:57 Download gff for RE18604.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18421415..18421553 1..139 100 -> Plus
2R 18424127..18424251 140..264 100 -> Plus
2R 18424326..18424486 265..425 100 -> Plus
2R 18424872..18425034 426..588 100 -> Plus
2R 18425340..18426219 589..1468 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:39:15 Download gff for RE18604.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14311632..14311756 140..264 100 -> Plus
arm_2R 14311831..14311991 265..425 100 -> Plus
arm_2R 14312377..14312539 426..588 100 -> Plus
arm_2R 14308920..14309058 1..139 100 -> Plus
arm_2R 14312845..14313724 589..1468 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:35:12 Download gff for RE18604.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18426539..18427418 589..1468 100   Plus
2R 18422614..18422752 1..139 100 -> Plus
2R 18425326..18425450 140..264 100 -> Plus
2R 18425525..18425685 265..425 100 -> Plus
2R 18426071..18426233 426..588 100 -> Plus

RE18604.pep Sequence

Translation from 129 to 695

> RE18604.pep
MEDHNTANLSEPASPANSVASAEIAAEFAALSVEEKEQRRAEWSQELARV
EEEINTLRTVLASKTRHASDLKRKLGITVWKEVTDDVNQGLKNLKESTVY
QRTESVLKSTGEKTASVFGSITSGISSKLSQMKNSESMRSIEASVGSAYE
NVKTKVTSRSGSVSSFPDALDENNTSSGLNSPTDSLPK*

RE18604.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 03:28:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12177-PA 351 GF12177-PA 148..351 5..188 819 87.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 03:28:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21893-PA 364 GG21893-PA 161..364 5..188 892 89.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 03:28:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21673-PA 351 GH21673-PA 148..351 5..188 842 83.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:40:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG5174-PH 188 CG5174-PH 1..188 1..188 919 100 Plus
CG5174-PM 202 CG5174-PM 19..202 5..188 895 100 Plus
CG5174-PA 208 CG5174-PA 1..208 1..188 888 90.4 Plus
CG5174-PL 209 CG5174-PL 1..209 1..188 870 89.5 Plus
CG5174-PB 355 CG5174-PB 152..355 5..188 864 90.2 Plus
CG5174-PN 222 CG5174-PN 1..222 1..188 863 84.7 Plus
CG5174-PP 365 CG5174-PP 148..365 5..188 839 84.4 Plus
CG5174-PO 369 CG5174-PO 152..369 5..188 839 84.4 Plus
CG5174-PG 166 CG5174-PG 1..153 1..153 744 100 Plus
CG5174-PJ 186 CG5174-PJ 1..173 1..153 713 88.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 03:28:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20126-PA 350 GI20126-PA 147..350 5..188 847 83.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 03:28:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17776-PA 372 GL17776-PA 165..372 1..188 802 83.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 03:28:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18710-PC 208 GA18710-PC 1..208 1..188 834 85.1 Plus
Dpse\GA18710-PA 374 GA18710-PA 167..374 1..188 801 83.2 Plus
Dpse\GA18710-PB 361 GA18710-PB 158..361 5..188 800 84.8 Plus
Dpse\GA18710-PD 184 GA18710-PD 1..173 1..153 661 83.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 03:28:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21885-PA 364 GM21885-PA 161..364 5..188 902 89.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 03:28:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11382-PA 221 GD11382-PA 18..221 5..188 902 89.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 03:28:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19896-PA 350 GJ19896-PA 147..350 5..188 785 83.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 03:28:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22994-PA 352 GK22994-PA 149..352 5..188 805 84.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 03:28:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11969-PA 371 GE11969-PA 168..371 5..188 890 88.7 Plus

RE18604.hyp Sequence

Translation from 129 to 695

> RE18604.hyp
MEDHNTANLSEPASPANSVASAEIAAEFAALSVEEKEQRRAEWSQELARV
EEEINTLRTVLASKTRHASDLKRKLGITVWKEVTDDVNQGLKNLKESTVY
QRTESVLKSTGEKTASVFGSITSGISSKLSQMKNSESMRSIEASVGSAYE
NVKTKVTSRSGSVSSFPDALDENNTSSGLNSPTDSLPK*

RE18604.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:31:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG5174-PH 188 CG5174-PH 1..188 1..188 919 100 Plus
CG5174-PM 202 CG5174-PM 19..202 5..188 895 100 Plus
CG5174-PA 208 CG5174-PA 1..208 1..188 888 90.4 Plus
CG5174-PL 209 CG5174-PL 1..209 1..188 870 89.5 Plus
CG5174-PN 222 CG5174-PN 1..222 1..188 863 84.7 Plus