Clone RE18615 Report

Search the DGRC for RE18615

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:186
Well:15
Vector:pFlc-1
Associated Gene/TranscriptSec61beta-RA
Protein status:RE18615.pep: gold
Sequenced Size:833

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10130 2001-12-14 Blastp of sequenced clone
CG10130 2002-01-01 Sim4 clustering to Release 2
Sec61beta 2008-04-29 Release 5.5 accounting
Sec61beta 2008-04-29 Stopped prior to 5.5
Sec61beta 2008-08-15 Release 5.9 accounting
Sec61beta 2008-12-18 5.12 accounting

Clone Sequence Records

RE18615.complete Sequence

833 bp (833 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071155

> RE18615.complete
CTATCGGCAGCGGTGCCACCACCAAAGTGACGTGGAACGAAAAAAGACGA
AGCGACACGAAGCCGAGCACGTCAGATTCAGATTCACGTTCAGATTCCAC
TTCGCCCGTTCATATTTTCCAGGTCAGTCGGTCCAGAGGAACAGATAGCC
CAAAATGCCCGCTCCAGCCAGTTCAACGTCCGTGGGCAGCGGATCGCGCT
CCCCCAGCAAATTGTCGGCGCCACGTAGCGCCGGATCCGGAGGCGGCAGC
ACCCTGAAGCAGCGCAAGACCACCACCAGCACCACAGCGGCCCGGAGCCG
TGCACCCGGCGGAGCCGGAACTGGTGGCATGTGGCGTTTCTACACGGACG
ACTCGCCCGGTATCAAAGTTGGTCCCGTACCCGTGCTGGTCATGTCGCTG
CTGTTCATCGCTTCCGTCTTCATGCTGCACATTTGGGGCAAATACAATCG
TTCTTAAGCCATGCATTTCGTAGCCAATAAAATACTTTCACCTCAACGAG
CGTGAACAATGTCGACGTCATCATTTCTTTTGCTGCGAGATAAGAAGAGA
TCCATTCCGCTTGTTGAGGCATTGGTGTGTTTCCACATGAAATTAATTAT
ACCTAAGCTTAAGTTAAAAACCTGTTTAAACGTAATGCATATTTTCAAAA
TTTAATCGTTTTCCCCCAATCCGTTCGTTCATCCGGCGGGCTGAGAATTC
ATTCCACAATTTATCGTGGTCATGTGCATCAGAAATTCCGCGCGCAGCCG
TTGCAATTCAAGAACTTGTAAGACATTCAACGAAAAGTGTTAAGAACAAA
TAAATTTTGTATTAAACAAAAAAAAAAAAAAAA

RE18615.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:45:15
Subject Length Description Subject Range Query Range Score Percent Strand
Sec61beta-RA 990 Sec61beta-RA 98..917 1..820 4070 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:59:35
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 10506537..10506984 370..817 2210 99.6 Plus
chr2R 21145070 chr2R 10506261..10506473 157..369 1065 100 Plus
chr2R 21145070 chr2R 10506049..10506205 1..157 785 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:39:38 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:59:34
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14619234..14619684 370..820 2225 99.6 Plus
2R 25286936 2R 14618958..14619170 157..369 1065 100 Plus
2R 25286936 2R 14618746..14618902 1..157 785 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:11:50
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 14620433..14620883 370..820 2225 99.5 Plus
2R 25260384 2R 14620157..14620369 157..369 1065 100 Plus
2R 25260384 2R 14619945..14620101 1..157 785 100 Plus
Blast to na_te.dros performed 2019-03-16 11:59:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dbuz\Newton 1510 Dbuz\Newton NEWTON 1510bp 677..732 644..590 115 69.6 Minus

RE18615.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:00:39 Download gff for RE18615.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 10506049..10506205 1..157 100 -> Plus
chr2R 10506262..10506473 158..369 100 -> Plus
chr2R 10506537..10506984 370..817 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:59:48 Download gff for RE18615.complete
Subject Subject Range Query Range Percent Splice Strand
Sec61beta-RA 1..303 155..457 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:12:10 Download gff for RE18615.complete
Subject Subject Range Query Range Percent Splice Strand
Sec61beta-RA 1..303 155..457 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:44:22 Download gff for RE18615.complete
Subject Subject Range Query Range Percent Splice Strand
Sec61beta-RA 1..303 155..457 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:36:24 Download gff for RE18615.complete
Subject Subject Range Query Range Percent Splice Strand
Sec61beta-RA 1..303 155..457 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:32:54 Download gff for RE18615.complete
Subject Subject Range Query Range Percent Splice Strand
Sec61beta-RA 1..303 155..457 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:42:44 Download gff for RE18615.complete
Subject Subject Range Query Range Percent Splice Strand
Sec61beta-RA 20..836 1..817 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:12:10 Download gff for RE18615.complete
Subject Subject Range Query Range Percent Splice Strand
Sec61beta-RA 20..836 1..817 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:44:22 Download gff for RE18615.complete
Subject Subject Range Query Range Percent Splice Strand
Sec61beta-RA 1..792 26..817 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:36:24 Download gff for RE18615.complete
Subject Subject Range Query Range Percent Splice Strand
Sec61beta-RA 20..836 1..817 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:32:54 Download gff for RE18615.complete
Subject Subject Range Query Range Percent Splice Strand
Sec61beta-RA 1..792 26..817 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:00:39 Download gff for RE18615.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14618746..14618902 1..157 100 -> Plus
2R 14618959..14619170 158..369 100 -> Plus
2R 14619234..14619681 370..817 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:00:39 Download gff for RE18615.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14618746..14618902 1..157 100 -> Plus
2R 14618959..14619170 158..369 100 -> Plus
2R 14619234..14619681 370..817 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:00:39 Download gff for RE18615.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14618746..14618902 1..157 100 -> Plus
2R 14618959..14619170 158..369 100 -> Plus
2R 14619234..14619681 370..817 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:44:22 Download gff for RE18615.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10506464..10506675 158..369 100 -> Plus
arm_2R 10506251..10506407 1..157 100 -> Plus
arm_2R 10506739..10507186 370..817 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:13:49 Download gff for RE18615.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14620158..14620369 158..369 100 -> Plus
2R 14620433..14620880 370..817 99   Plus
2R 14619945..14620101 1..157 100 -> Plus

RE18615.hyp Sequence

Translation from 154 to 456

> RE18615.hyp
MPAPASSTSVGSGSRSPSKLSAPRSAGSGGGSTLKQRKTTTSTTAARSRA
PGGAGTGGMWRFYTDDSPGIKVGPVPVLVMSLLFIASVFMLHIWGKYNRS
*

RE18615.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:41:16
Subject Length Description Subject Range Query Range Score Percent Strand
Sec61beta-PA 100 CG10130-PA 1..100 1..100 514 100 Plus

RE18615.pep Sequence

Translation from 154 to 456

> RE18615.pep
MPAPASSTSVGSGSRSPSKLSAPRSAGSGGGSTLKQRKTTTSTTAARSRA
PGGAGTGGMWRFYTDDSPGIKVGPVPVLVMSLLFIASVFMLHIWGKYNRS
*

RE18615.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:17:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11335-PA 100 GF11335-PA 1..100 1..100 487 97 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:17:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20468-PA 100 GG20468-PA 1..100 1..100 496 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:17:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21806-PA 99 GH21806-PA 1..99 1..100 478 98 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:35:17
Subject Length Description Subject Range Query Range Score Percent Strand
Sec61beta-PA 100 CG10130-PA 1..100 1..100 514 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:17:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20777-PA 109 GI20777-PA 12..109 2..100 473 98 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:17:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11450-PA 100 GL11450-PA 1..100 1..100 490 98 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:17:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10096-PA 100 GA10096-PA 1..100 1..100 490 98 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:17:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21558-PA 100 GM21558-PA 1..100 1..100 496 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:17:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11064-PA 100 GD11064-PA 1..100 1..100 496 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:17:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20512-PA 99 GJ20512-PA 1..99 1..100 478 98 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:17:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19628-PA 100 GK19628-PA 1..100 1..100 486 97 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:17:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Sec61beta-PA 100 GE13599-PA 1..100 1..100 496 100 Plus