BDGP Sequence Production Resources |
Search the DGRC for RE18615
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 186 |
Well: | 15 |
Vector: | pFlc-1 |
Associated Gene/Transcript | Sec61beta-RA |
Protein status: | RE18615.pep: gold |
Sequenced Size: | 833 |
Gene | Date | Evidence |
---|---|---|
CG10130 | 2001-12-14 | Blastp of sequenced clone |
CG10130 | 2002-01-01 | Sim4 clustering to Release 2 |
Sec61beta | 2008-04-29 | Release 5.5 accounting |
Sec61beta | 2008-04-29 | Stopped prior to 5.5 |
Sec61beta | 2008-08-15 | Release 5.9 accounting |
Sec61beta | 2008-12-18 | 5.12 accounting |
833 bp (833 high quality bases) assembled on 2001-12-14
GenBank Submission: AY071155
> RE18615.complete CTATCGGCAGCGGTGCCACCACCAAAGTGACGTGGAACGAAAAAAGACGA AGCGACACGAAGCCGAGCACGTCAGATTCAGATTCACGTTCAGATTCCAC TTCGCCCGTTCATATTTTCCAGGTCAGTCGGTCCAGAGGAACAGATAGCC CAAAATGCCCGCTCCAGCCAGTTCAACGTCCGTGGGCAGCGGATCGCGCT CCCCCAGCAAATTGTCGGCGCCACGTAGCGCCGGATCCGGAGGCGGCAGC ACCCTGAAGCAGCGCAAGACCACCACCAGCACCACAGCGGCCCGGAGCCG TGCACCCGGCGGAGCCGGAACTGGTGGCATGTGGCGTTTCTACACGGACG ACTCGCCCGGTATCAAAGTTGGTCCCGTACCCGTGCTGGTCATGTCGCTG CTGTTCATCGCTTCCGTCTTCATGCTGCACATTTGGGGCAAATACAATCG TTCTTAAGCCATGCATTTCGTAGCCAATAAAATACTTTCACCTCAACGAG CGTGAACAATGTCGACGTCATCATTTCTTTTGCTGCGAGATAAGAAGAGA TCCATTCCGCTTGTTGAGGCATTGGTGTGTTTCCACATGAAATTAATTAT ACCTAAGCTTAAGTTAAAAACCTGTTTAAACGTAATGCATATTTTCAAAA TTTAATCGTTTTCCCCCAATCCGTTCGTTCATCCGGCGGGCTGAGAATTC ATTCCACAATTTATCGTGGTCATGTGCATCAGAAATTCCGCGCGCAGCCG TTGCAATTCAAGAACTTGTAAGACATTCAACGAAAAGTGTTAAGAACAAA TAAATTTTGTATTAAACAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Sec61beta-RA | 990 | Sec61beta-RA | 98..917 | 1..820 | 4070 | 99.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 10506537..10506984 | 370..817 | 2210 | 99.6 | Plus |
chr2R | 21145070 | chr2R | 10506261..10506473 | 157..369 | 1065 | 100 | Plus |
chr2R | 21145070 | chr2R | 10506049..10506205 | 1..157 | 785 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 14619234..14619684 | 370..820 | 2225 | 99.6 | Plus |
2R | 25286936 | 2R | 14618958..14619170 | 157..369 | 1065 | 100 | Plus |
2R | 25286936 | 2R | 14618746..14618902 | 1..157 | 785 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 14620433..14620883 | 370..820 | 2225 | 99.5 | Plus |
2R | 25260384 | 2R | 14620157..14620369 | 157..369 | 1065 | 100 | Plus |
2R | 25260384 | 2R | 14619945..14620101 | 1..157 | 785 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dbuz\Newton | 1510 | Dbuz\Newton NEWTON 1510bp | 677..732 | 644..590 | 115 | 69.6 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 10506049..10506205 | 1..157 | 100 | -> | Plus |
chr2R | 10506262..10506473 | 158..369 | 100 | -> | Plus |
chr2R | 10506537..10506984 | 370..817 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Sec61beta-RA | 1..303 | 155..457 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Sec61beta-RA | 1..303 | 155..457 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Sec61beta-RA | 1..303 | 155..457 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Sec61beta-RA | 1..303 | 155..457 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Sec61beta-RA | 1..303 | 155..457 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Sec61beta-RA | 20..836 | 1..817 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Sec61beta-RA | 20..836 | 1..817 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Sec61beta-RA | 1..792 | 26..817 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Sec61beta-RA | 20..836 | 1..817 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Sec61beta-RA | 1..792 | 26..817 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 14618746..14618902 | 1..157 | 100 | -> | Plus |
2R | 14618959..14619170 | 158..369 | 100 | -> | Plus |
2R | 14619234..14619681 | 370..817 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 14618746..14618902 | 1..157 | 100 | -> | Plus |
2R | 14618959..14619170 | 158..369 | 100 | -> | Plus |
2R | 14619234..14619681 | 370..817 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 14618746..14618902 | 1..157 | 100 | -> | Plus |
2R | 14618959..14619170 | 158..369 | 100 | -> | Plus |
2R | 14619234..14619681 | 370..817 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 10506464..10506675 | 158..369 | 100 | -> | Plus |
arm_2R | 10506251..10506407 | 1..157 | 100 | -> | Plus |
arm_2R | 10506739..10507186 | 370..817 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 14620158..14620369 | 158..369 | 100 | -> | Plus |
2R | 14620433..14620880 | 370..817 | 99 | Plus | |
2R | 14619945..14620101 | 1..157 | 100 | -> | Plus |
Translation from 154 to 456
> RE18615.hyp MPAPASSTSVGSGSRSPSKLSAPRSAGSGGGSTLKQRKTTTSTTAARSRA PGGAGTGGMWRFYTDDSPGIKVGPVPVLVMSLLFIASVFMLHIWGKYNRS *
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Sec61beta-PA | 100 | CG10130-PA | 1..100 | 1..100 | 514 | 100 | Plus |
Translation from 154 to 456
> RE18615.pep MPAPASSTSVGSGSRSPSKLSAPRSAGSGGGSTLKQRKTTTSTTAARSRA PGGAGTGGMWRFYTDDSPGIKVGPVPVLVMSLLFIASVFMLHIWGKYNRS *
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF11335-PA | 100 | GF11335-PA | 1..100 | 1..100 | 487 | 97 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG20468-PA | 100 | GG20468-PA | 1..100 | 1..100 | 496 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH21806-PA | 99 | GH21806-PA | 1..99 | 1..100 | 478 | 98 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Sec61beta-PA | 100 | CG10130-PA | 1..100 | 1..100 | 514 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI20777-PA | 109 | GI20777-PA | 12..109 | 2..100 | 473 | 98 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL11450-PA | 100 | GL11450-PA | 1..100 | 1..100 | 490 | 98 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA10096-PA | 100 | GA10096-PA | 1..100 | 1..100 | 490 | 98 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM21558-PA | 100 | GM21558-PA | 1..100 | 1..100 | 496 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD11064-PA | 100 | GD11064-PA | 1..100 | 1..100 | 496 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ20512-PA | 99 | GJ20512-PA | 1..99 | 1..100 | 478 | 98 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK19628-PA | 100 | GK19628-PA | 1..100 | 1..100 | 486 | 97 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\Sec61beta-PA | 100 | GE13599-PA | 1..100 | 1..100 | 496 | 100 | Plus |