Clone RE18653 Report

Search the DGRC for RE18653

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:186
Well:53
Vector:pFlc-1
Associated Gene/TranscriptRpS7-RA
Protein status:RE18653.pep: gold
Preliminary Size:790
Sequenced Size:813

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1883 2002-01-01 Sim4 clustering to Release 2
CG1883 2002-06-10 Blastp of sequenced clone
CG1883 2003-01-01 Sim4 clustering to Release 3
RpS7 2008-04-29 Release 5.5 accounting
RpS7 2008-08-15 Release 5.9 accounting
RpS7 2008-12-18 5.12 accounting

Clone Sequence Records

RE18653.complete Sequence

813 bp (813 high quality bases) assembled on 2002-06-10

GenBank Submission: AY071156

> RE18653.complete
AGTATCGCACAACGTTCGCGCGTGTCTCATCGATAACAACTCGCTCTGTT
TTCCACCTCTACGTCGTGGCTCGACTTCCTTTCCTGTCAAAATAGTCGAC
AAAGATGGCTATCGGCTCCAAGATTATCAAGCCCGGCGGCTCGGATCCCG
ATGACTTCGAGAAGTCCATTGCCCAGGCGTTGGTGGAACTCGAGGCCAAC
AGCGACCTGAAGCCCTACCTGCGCGATCTGCACATCACCCGTGCCCGCGA
GATCGAGTTCGGCAGCAAGAAGGCCGTCATCATCTACGTGCCCATTCCAC
AGCAGAAGGTGTTCCAGAAGATCCAGATCATCCTGGTCCGCGAGCTGGAG
AAGAAGTTCTCGGGCAAGCACGTCGTCGTGATTGCGGAGCGCAAGATCCT
GCCCAAGCCCACGCGCAAGGCCCGCAACCCCCTCAAGCAGAAGCGTCCAC
GCTCCAGGACTCTGACCGCTGTGTACGACGCCATCCTTGAGGATCTGGTC
TTCCCCGCCGAGATTGTGGGCAAGCGCATCCGCGTCAAGCTGGACGGCTC
CCAGCTGGTCAAGGTGCACCTGGACAAGAACCAGCAGACCACCATTGAAC
ACAAAGTCGACACCTTCACCTCGGTCTACAAGAAGCTGACTGGTCGCGAT
GTTACCTTCGAATTCCCCGACAACTACCTGAATGTCTAGAGCGGCGGGTT
CTCGTTCGAGAGTAGCACTGGTTCGCCGGTTCATCTGGGAATATGAGTTT
TTTACATGAGCTAGAGAACGTGAATAAACATTAAACAATCTAAAACCAAA
AAAAAAAAAAAAA

RE18653.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:49:27
Subject Length Description Subject Range Query Range Score Percent Strand
RpS7-RA 1093 RpS7-RA 123..918 1..796 3980 100 Plus
RpS7-RD 1093 RpS7-RD 123..918 1..796 3980 100 Plus
RpS7.c 1323 RpS7.c 55..850 1..796 3980 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 14:06:02
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 26030542..26030878 607..271 1670 99.7 Minus
chr3R 27901430 chr3R 26028982..26029172 796..606 955 100 Minus
chr3R 27901430 chr3R 26030942..26031112 273..103 855 100 Minus
chr3R 27901430 chr3R 26031366..26031473 108..1 525 99.1 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:39:42 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 14:06:00
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30208091..30208427 607..271 1685 100 Minus
3R 32079331 3R 30206531..30206721 796..606 955 100 Minus
3R 32079331 3R 30208489..30208659 273..103 855 100 Minus
3R 32079331 3R 30208913..30209020 108..1 525 99.1 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:22:13
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 29948922..29949258 607..271 1685 100 Minus
3R 31820162 3R 29947362..29947552 796..606 955 100 Minus
3R 31820162 3R 29949320..29949490 273..103 855 100 Minus
3R 31820162 3R 29949744..29949851 108..1 525 99 Minus
Blast to na_te.dros performed on 2019-03-15 14:06:01 has no hits.

RE18653.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 14:07:11 Download gff for RE18653.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 26028981..26029172 606..797 99 <- Minus
chr3R 26030544..26030876 273..605 99 <- Minus
chr3R 26030943..26031110 105..272 100 <- Minus
chr3R 26031370..26031473 1..104 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:59:53 Download gff for RE18653.complete
Subject Subject Range Query Range Percent Splice Strand
RpS7-RC 1..585 105..689 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:25:04 Download gff for RE18653.complete
Subject Subject Range Query Range Percent Splice Strand
RpS7-RC 1..585 105..689 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:18:16 Download gff for RE18653.complete
Subject Subject Range Query Range Percent Splice Strand
RpS7-RA 1..585 105..689 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:15:38 Download gff for RE18653.complete
Subject Subject Range Query Range Percent Splice Strand
RpS7-RC 1..585 105..689 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:50:12 Download gff for RE18653.complete
Subject Subject Range Query Range Percent Splice Strand
RpS7-RA 1..585 105..689 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:52:47 Download gff for RE18653.complete
Subject Subject Range Query Range Percent Splice Strand
RpS7-RD 1..796 1..797 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:25:04 Download gff for RE18653.complete
Subject Subject Range Query Range Percent Splice Strand
RpS7-RD 1..796 1..797 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:18:16 Download gff for RE18653.complete
Subject Subject Range Query Range Percent Splice Strand
RpS7-RD 1..796 1..797 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:15:38 Download gff for RE18653.complete
Subject Subject Range Query Range Percent Splice Strand
RpS7-RD 1..796 1..797 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:50:12 Download gff for RE18653.complete
Subject Subject Range Query Range Percent Splice Strand
RpS7-RD 1..796 1..797 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:07:11 Download gff for RE18653.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30206530..30206721 606..797 99 <- Minus
3R 30208093..30208425 273..605 100 <- Minus
3R 30208490..30208657 105..272 100 <- Minus
3R 30208917..30209020 1..104 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:07:11 Download gff for RE18653.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30206530..30206721 606..797 99 <- Minus
3R 30208093..30208425 273..605 100 <- Minus
3R 30208490..30208657 105..272 100 <- Minus
3R 30208917..30209020 1..104 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:07:11 Download gff for RE18653.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30206530..30206721 606..797 99 <- Minus
3R 30208093..30208425 273..605 100 <- Minus
3R 30208490..30208657 105..272 100 <- Minus
3R 30208917..30209020 1..104 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:18:16 Download gff for RE18653.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 26032252..26032443 606..797 99 <- Minus
arm_3R 26033815..26034147 273..605 100 <- Minus
arm_3R 26034212..26034379 105..272 100 <- Minus
arm_3R 26034639..26034742 1..104 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:48:46 Download gff for RE18653.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29948924..29949256 273..605 100 <- Minus
3R 29949321..29949488 105..272 100 <- Minus
3R 29949748..29949851 1..104 100   Minus
3R 29947361..29947552 606..797 99 <- Minus

RE18653.pep Sequence

Translation from 104 to 688

> RE18653.pep
MAIGSKIIKPGGSDPDDFEKSIAQALVELEANSDLKPYLRDLHITRAREI
EFGSKKAVIIYVPIPQQKVFQKIQIILVRELEKKFSGKHVVVIAERKILP
KPTRKARNPLKQKRPRSRTLTAVYDAILEDLVFPAEIVGKRIRVKLDGSQ
LVKVHLDKNQQTTIEHKVDTFTSVYKKLTGRDVTFEFPDNYLNV*

RE18653.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:50:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16191-PA 194 GF16191-PA 1..194 1..194 988 98.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:50:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11951-PA 194 GG11951-PA 1..194 1..194 999 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:50:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18420-PA 194 GH18420-PA 1..194 1..194 989 98.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:15:03
Subject Length Description Subject Range Query Range Score Percent Strand
RpS7-PE 194 CG1883-PE 1..194 1..194 974 100 Plus
RpS7-PC 194 CG1883-PC 1..194 1..194 974 100 Plus
RpS7-PA 194 CG1883-PA 1..194 1..194 974 100 Plus
RpS7-PD 194 CG1883-PD 1..194 1..194 974 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:50:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24321-PA 194 GI24321-PA 1..194 1..194 990 98.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:50:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14128-PA 194 GL14128-PA 1..194 1..194 991 99 Plus
Dper\GL14058-PA 194 GL14058-PA 1..194 1..194 991 99 Plus
Dper\GL11058-PA 194 GL11058-PA 1..194 1..194 985 98.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:50:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15097-PA 194 GA15097-PA 1..194 1..194 991 99 Plus
Dpse\GA15097-PB 194 GA15097-PB 1..194 1..194 991 99 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:50:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12166-PA 194 GM12166-PA 1..194 1..194 999 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:50:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17201-PA 194 GD17201-PA 1..194 1..194 999 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:50:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10407-PA 202 GJ10407-PA 15..202 7..194 920 95.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:50:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13140-PA 194 GK13140-PA 1..194 1..194 989 98.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:50:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23400-PA 194 GE23400-PA 1..194 1..194 994 99.5 Plus

RE18653.hyp Sequence

Translation from 104 to 688

> RE18653.hyp
MAIGSKIIKPGGSDPDDFEKSIAQALVELEANSDLKPYLRDLHITRAREI
EFGSKKAVIIYVPIPQQKVFQKIQIILVRELEKKFSGKHVVVIAERKILP
KPTRKARNPLKQKRPRSRTLTAVYDAILEDLVFPAEIVGKRIRVKLDGSQ
LVKVHLDKNQQTTIEHKVDTFTSVYKKLTGRDVTFEFPDNYLNV*

RE18653.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:03:45
Subject Length Description Subject Range Query Range Score Percent Strand
RpS7-PE 194 CG1883-PE 1..194 1..194 974 100 Plus
RpS7-PC 194 CG1883-PC 1..194 1..194 974 100 Plus
RpS7-PA 194 CG1883-PA 1..194 1..194 974 100 Plus
RpS7-PD 194 CG1883-PD 1..194 1..194 974 100 Plus