BDGP Sequence Production Resources |
Search the DGRC for RE18653
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 186 |
Well: | 53 |
Vector: | pFlc-1 |
Associated Gene/Transcript | RpS7-RA |
Protein status: | RE18653.pep: gold |
Preliminary Size: | 790 |
Sequenced Size: | 813 |
Gene | Date | Evidence |
---|---|---|
CG1883 | 2002-01-01 | Sim4 clustering to Release 2 |
CG1883 | 2002-06-10 | Blastp of sequenced clone |
CG1883 | 2003-01-01 | Sim4 clustering to Release 3 |
RpS7 | 2008-04-29 | Release 5.5 accounting |
RpS7 | 2008-08-15 | Release 5.9 accounting |
RpS7 | 2008-12-18 | 5.12 accounting |
813 bp (813 high quality bases) assembled on 2002-06-10
GenBank Submission: AY071156
> RE18653.complete AGTATCGCACAACGTTCGCGCGTGTCTCATCGATAACAACTCGCTCTGTT TTCCACCTCTACGTCGTGGCTCGACTTCCTTTCCTGTCAAAATAGTCGAC AAAGATGGCTATCGGCTCCAAGATTATCAAGCCCGGCGGCTCGGATCCCG ATGACTTCGAGAAGTCCATTGCCCAGGCGTTGGTGGAACTCGAGGCCAAC AGCGACCTGAAGCCCTACCTGCGCGATCTGCACATCACCCGTGCCCGCGA GATCGAGTTCGGCAGCAAGAAGGCCGTCATCATCTACGTGCCCATTCCAC AGCAGAAGGTGTTCCAGAAGATCCAGATCATCCTGGTCCGCGAGCTGGAG AAGAAGTTCTCGGGCAAGCACGTCGTCGTGATTGCGGAGCGCAAGATCCT GCCCAAGCCCACGCGCAAGGCCCGCAACCCCCTCAAGCAGAAGCGTCCAC GCTCCAGGACTCTGACCGCTGTGTACGACGCCATCCTTGAGGATCTGGTC TTCCCCGCCGAGATTGTGGGCAAGCGCATCCGCGTCAAGCTGGACGGCTC CCAGCTGGTCAAGGTGCACCTGGACAAGAACCAGCAGACCACCATTGAAC ACAAAGTCGACACCTTCACCTCGGTCTACAAGAAGCTGACTGGTCGCGAT GTTACCTTCGAATTCCCCGACAACTACCTGAATGTCTAGAGCGGCGGGTT CTCGTTCGAGAGTAGCACTGGTTCGCCGGTTCATCTGGGAATATGAGTTT TTTACATGAGCTAGAGAACGTGAATAAACATTAAACAATCTAAAACCAAA AAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 26030542..26030878 | 607..271 | 1670 | 99.7 | Minus |
chr3R | 27901430 | chr3R | 26028982..26029172 | 796..606 | 955 | 100 | Minus |
chr3R | 27901430 | chr3R | 26030942..26031112 | 273..103 | 855 | 100 | Minus |
chr3R | 27901430 | chr3R | 26031366..26031473 | 108..1 | 525 | 99.1 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 30208091..30208427 | 607..271 | 1685 | 100 | Minus |
3R | 32079331 | 3R | 30206531..30206721 | 796..606 | 955 | 100 | Minus |
3R | 32079331 | 3R | 30208489..30208659 | 273..103 | 855 | 100 | Minus |
3R | 32079331 | 3R | 30208913..30209020 | 108..1 | 525 | 99.1 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 29948922..29949258 | 607..271 | 1685 | 100 | Minus |
3R | 31820162 | 3R | 29947362..29947552 | 796..606 | 955 | 100 | Minus |
3R | 31820162 | 3R | 29949320..29949490 | 273..103 | 855 | 100 | Minus |
3R | 31820162 | 3R | 29949744..29949851 | 108..1 | 525 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 26028981..26029172 | 606..797 | 99 | <- | Minus |
chr3R | 26030544..26030876 | 273..605 | 99 | <- | Minus |
chr3R | 26030943..26031110 | 105..272 | 100 | <- | Minus |
chr3R | 26031370..26031473 | 1..104 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS7-RC | 1..585 | 105..689 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS7-RC | 1..585 | 105..689 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS7-RA | 1..585 | 105..689 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS7-RC | 1..585 | 105..689 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS7-RA | 1..585 | 105..689 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS7-RD | 1..796 | 1..797 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS7-RD | 1..796 | 1..797 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS7-RD | 1..796 | 1..797 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS7-RD | 1..796 | 1..797 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS7-RD | 1..796 | 1..797 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 30206530..30206721 | 606..797 | 99 | <- | Minus |
3R | 30208093..30208425 | 273..605 | 100 | <- | Minus |
3R | 30208490..30208657 | 105..272 | 100 | <- | Minus |
3R | 30208917..30209020 | 1..104 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 30206530..30206721 | 606..797 | 99 | <- | Minus |
3R | 30208093..30208425 | 273..605 | 100 | <- | Minus |
3R | 30208490..30208657 | 105..272 | 100 | <- | Minus |
3R | 30208917..30209020 | 1..104 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 30206530..30206721 | 606..797 | 99 | <- | Minus |
3R | 30208093..30208425 | 273..605 | 100 | <- | Minus |
3R | 30208490..30208657 | 105..272 | 100 | <- | Minus |
3R | 30208917..30209020 | 1..104 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 26032252..26032443 | 606..797 | 99 | <- | Minus |
arm_3R | 26033815..26034147 | 273..605 | 100 | <- | Minus |
arm_3R | 26034212..26034379 | 105..272 | 100 | <- | Minus |
arm_3R | 26034639..26034742 | 1..104 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 29948924..29949256 | 273..605 | 100 | <- | Minus |
3R | 29949321..29949488 | 105..272 | 100 | <- | Minus |
3R | 29949748..29949851 | 1..104 | 100 | Minus | |
3R | 29947361..29947552 | 606..797 | 99 | <- | Minus |
Translation from 104 to 688
> RE18653.pep MAIGSKIIKPGGSDPDDFEKSIAQALVELEANSDLKPYLRDLHITRAREI EFGSKKAVIIYVPIPQQKVFQKIQIILVRELEKKFSGKHVVVIAERKILP KPTRKARNPLKQKRPRSRTLTAVYDAILEDLVFPAEIVGKRIRVKLDGSQ LVKVHLDKNQQTTIEHKVDTFTSVYKKLTGRDVTFEFPDNYLNV*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF16191-PA | 194 | GF16191-PA | 1..194 | 1..194 | 988 | 98.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG11951-PA | 194 | GG11951-PA | 1..194 | 1..194 | 999 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH18420-PA | 194 | GH18420-PA | 1..194 | 1..194 | 989 | 98.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpS7-PE | 194 | CG1883-PE | 1..194 | 1..194 | 974 | 100 | Plus |
RpS7-PC | 194 | CG1883-PC | 1..194 | 1..194 | 974 | 100 | Plus |
RpS7-PA | 194 | CG1883-PA | 1..194 | 1..194 | 974 | 100 | Plus |
RpS7-PD | 194 | CG1883-PD | 1..194 | 1..194 | 974 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI24321-PA | 194 | GI24321-PA | 1..194 | 1..194 | 990 | 98.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL14128-PA | 194 | GL14128-PA | 1..194 | 1..194 | 991 | 99 | Plus |
Dper\GL14058-PA | 194 | GL14058-PA | 1..194 | 1..194 | 991 | 99 | Plus |
Dper\GL11058-PA | 194 | GL11058-PA | 1..194 | 1..194 | 985 | 98.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA15097-PA | 194 | GA15097-PA | 1..194 | 1..194 | 991 | 99 | Plus |
Dpse\GA15097-PB | 194 | GA15097-PB | 1..194 | 1..194 | 991 | 99 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM12166-PA | 194 | GM12166-PA | 1..194 | 1..194 | 999 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD17201-PA | 194 | GD17201-PA | 1..194 | 1..194 | 999 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ10407-PA | 202 | GJ10407-PA | 15..202 | 7..194 | 920 | 95.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK13140-PA | 194 | GK13140-PA | 1..194 | 1..194 | 989 | 98.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE23400-PA | 194 | GE23400-PA | 1..194 | 1..194 | 994 | 99.5 | Plus |
Translation from 104 to 688
> RE18653.hyp MAIGSKIIKPGGSDPDDFEKSIAQALVELEANSDLKPYLRDLHITRAREI EFGSKKAVIIYVPIPQQKVFQKIQIILVRELEKKFSGKHVVVIAERKILP KPTRKARNPLKQKRPRSRTLTAVYDAILEDLVFPAEIVGKRIRVKLDGSQ LVKVHLDKNQQTTIEHKVDTFTSVYKKLTGRDVTFEFPDNYLNV*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpS7-PE | 194 | CG1883-PE | 1..194 | 1..194 | 974 | 100 | Plus |
RpS7-PC | 194 | CG1883-PC | 1..194 | 1..194 | 974 | 100 | Plus |
RpS7-PA | 194 | CG1883-PA | 1..194 | 1..194 | 974 | 100 | Plus |
RpS7-PD | 194 | CG1883-PD | 1..194 | 1..194 | 974 | 100 | Plus |