Clone RE18748 Report

Search the DGRC for RE18748

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:187
Well:48
Vector:pFlc-1
Associated Gene/TranscriptCG15390-RA
Protein status:RE18748.pep: gold
Preliminary Size:615
Sequenced Size:969

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15390 2002-01-01 Sim4 clustering to Release 2
CG15390 2002-02-22 Blastp of sequenced clone
CG15390 2003-01-01 Sim4 clustering to Release 3
CG15390 2008-04-29 Release 5.5 accounting
CG15390 2008-08-15 Release 5.9 accounting
CG15390 2008-12-18 5.12 accounting

Clone Sequence Records

RE18748.complete Sequence

969 bp (969 high quality bases) assembled on 2002-02-22

GenBank Submission: AY089593

> RE18748.complete
CATTGCAAAGAAGAAGAGATCAGCTGTTCATTGTTTTGCTCGCCGATTTA
AGAGGACATCGCCAAAAATGTTGCGGAAACTATTATTTAACACACAAGCT
GTATTAAAACAACAGTCAAACTTACATCACATAAGGCACTTGGCAACGCC
CAAGATATTGCAGCTTGAACAAATTCACATCGATGAAGCCATCAAAATAG
AACCCACGTTAGCTGTATTCTCACCTGAAATCTGGCGAAGGGCCCATCAA
ACTTTTCAAAACCACGGCTTGGAAACCGTGAATTTCCTTAGAATAGTTAC
CGGTAACCCCGCGATTTTGAAAAGAACGCCGGACAAAATAATAAGCTGCC
TGGAAATCTGGAGGGCCTGTCAATTCGGCGAGAATCTACTGCACCTGCTC
CTTACGAAGTACCCCGAGTTACTGGACGTTAGCGACTCCCACCAGTTACT
TTCCCACATCGGCTTCCTTCAAAGTCGCGTCTCCACCAGCAAAAATGTGT
GGAAGTGTTTGATGAACAGTCCGGATTTGATAGCACAATCCGAGGTATCT
ATTGAGGAGAAACTGAACTTCATCACAGACGTGATGCGCATAGAAGTGCC
GGAGTTGGTTAAATCGGCAGCCCTTACCTTGTCATTCGAGGAGCTGCGTT
GTCGCCACCAGTTCCTGCTTCGTTTGGGCCTCTTTAAGCCACGACCTCCG
AAAGCCGATCCAAATGAGCCGACTACGAACCCCAAACTCTATCAGATTAC
AGACACTTCCGAGAAGAGTTTCGCCACAAAGATTTGCCACGTCACCCTGC
CGGAATACGAAGCCTTCAAGGATCTCTACGCCAAGGAACTGGAGCAAAAG
TCCAGAAGAAAGGAGGAGGATGAGCTTAGTGATGAAGATGACTAATGTTA
CGTTTAATTATGGTTATAGTTTGTGCCAGCAAATAAACGCTTGTAAAAAT
ACGAAAAAAAAAAAAAAAA

RE18748.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:26:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG15390-RA 1035 CG15390-RA 12..967 1..956 4765 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:59:14
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 2374562..2375390 122..950 4115 99.8 Plus
chr2L 23010047 chr2L 2374385..2374505 1..121 575 98.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:39:45 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:59:12
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2374866..2375700 122..956 4160 99.9 Plus
2L 23513712 2L 2374689..2374809 1..121 605 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:55:08
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2374866..2375700 122..956 4160 99.8 Plus
2L 23513712 2L 2374689..2374809 1..121 605 100 Plus
Blast to na_te.dros performed on 2019-03-16 20:59:12 has no hits.

RE18748.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:00:27 Download gff for RE18748.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 2374385..2374505 1..121 98 -> Plus
chr2L 2374562..2375392 122..953 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:59:55 Download gff for RE18748.complete
Subject Subject Range Query Range Percent Splice Strand
CG15390-RA 1..828 68..895 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:39:58 Download gff for RE18748.complete
Subject Subject Range Query Range Percent Splice Strand
CG15390-RA 1..828 68..895 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:31:33 Download gff for RE18748.complete
Subject Subject Range Query Range Percent Splice Strand
CG15390-RA 1..828 68..895 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:09:44 Download gff for RE18748.complete
Subject Subject Range Query Range Percent Splice Strand
CG15390-RA 1..828 68..895 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:02:07 Download gff for RE18748.complete
Subject Subject Range Query Range Percent Splice Strand
CG15390-RA 1..828 68..895 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:04:56 Download gff for RE18748.complete
Subject Subject Range Query Range Percent Splice Strand
CG15390-RA 1..952 1..953 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:39:57 Download gff for RE18748.complete
Subject Subject Range Query Range Percent Splice Strand
CG15390-RA 1..952 1..953 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:31:33 Download gff for RE18748.complete
Subject Subject Range Query Range Percent Splice Strand
CG15390-RA 1..928 25..953 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:09:45 Download gff for RE18748.complete
Subject Subject Range Query Range Percent Splice Strand
CG15390-RA 1..952 1..953 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:02:07 Download gff for RE18748.complete
Subject Subject Range Query Range Percent Splice Strand
CG15390-RA 1..928 25..953 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:00:27 Download gff for RE18748.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2374689..2374809 1..121 100 -> Plus
2L 2374866..2375696 122..953 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:00:27 Download gff for RE18748.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2374689..2374809 1..121 100 -> Plus
2L 2374866..2375696 122..953 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:00:27 Download gff for RE18748.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2374689..2374809 1..121 100 -> Plus
2L 2374866..2375696 122..953 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:31:33 Download gff for RE18748.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 2374689..2374809 1..121 100 -> Plus
arm_2L 2374866..2375696 122..953 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:43:57 Download gff for RE18748.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2374866..2375696 122..953 99   Plus
2L 2374689..2374809 1..121 100 -> Plus

RE18748.hyp Sequence

Translation from 0 to 894

> RE18748.hyp
IAKKKRSAVHCFARRFKRTSPKMLRKLLFNTQAVLKQQSNLHHIRHLATP
KILQLEQIHIDEAIKIEPTLAVFSPEIWRRAHQTFQNHGLETVNFLRIVT
GNPAILKRTPDKIISCLEIWRACQFGENLLHLLLTKYPELLDVSDSHQLL
SHIGFLQSRVSTSKNVWKCLMNSPDLIAQSEVSIEEKLNFITDVMRIEVP
ELVKSAALTLSFEELRCRHQFLLRLGLFKPRPPKADPNEPTTNPKLYQIT
DTSEKSFATKICHVTLPEYEAFKDLYAKELEQKSRRKEEDELSDEDD*

RE18748.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:38:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG15390-PA 275 CG15390-PA 1..275 23..297 1423 100 Plus

RE18748.pep Sequence

Translation from 67 to 894

> RE18748.pep
MLRKLLFNTQAVLKQQSNLHHIRHLATPKILQLEQIHIDEAIKIEPTLAV
FSPEIWRRAHQTFQNHGLETVNFLRIVTGNPAILKRTPDKIISCLEIWRA
CQFGENLLHLLLTKYPELLDVSDSHQLLSHIGFLQSRVSTSKNVWKCLMN
SPDLIAQSEVSIEEKLNFITDVMRIEVPELVKSAALTLSFEELRCRHQFL
LRLGLFKPRPPKADPNEPTTNPKLYQITDTSEKSFATKICHVTLPEYEAF
KDLYAKELEQKSRRKEEDELSDEDD*

RE18748.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:21:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14621-PA 276 GF14621-PA 1..264 1..264 1182 81.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:21:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24850-PA 275 GG24850-PA 1..275 1..275 1361 92.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:21:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10253-PA 273 GH10253-PA 1..271 1..275 1042 70.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:24:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG15390-PA 275 CG15390-PA 1..275 1..275 1423 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:21:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15451-PA 278 GI15451-PA 1..277 1..274 1084 73.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:21:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18723-PA 280 GL18723-PA 1..269 1..265 1109 75.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:21:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13697-PA 280 GA13697-PA 1..269 1..265 1107 75.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:21:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18334-PA 275 GM18334-PA 1..265 1..265 1350 95.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:21:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23149-PA 275 GD23149-PA 1..265 1..265 1352 95.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:21:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17283-PA 283 GJ17283-PA 1..270 1..264 1031 71.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:21:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15153-PA 282 GK15153-PA 1..270 1..267 1034 69.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:21:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18148-PA 275 GE18148-PA 1..265 1..265 1326 94 Plus