Clone RE19105 Report

Search the DGRC for RE19105

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:191
Well:5
Vector:pFlc-1
Associated Gene/Transcriptfbp-RA
Protein status:RE19105.pep: gold
Sequenced Size:1214

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
fbp-RB 2009-06-22 Replacement based on scoring

Clone Sequence Records

RE19105.complete Sequence

1214 bp assembled on 2009-08-05

GenBank Submission: BT089035.1

> RE19105.complete
AGTGTCTTTAGATCAGCCGTCGACCGCGGTTCGTTGTTTGTTTGCCAGAG
TTTGTCGATTTGTTGAACCGCACCATTTACAGAGCGTACTGCAACTACAT
ACATATAACCAATAATGGCGGCCAGTAGCGGTGATTCCAAAATGACCCAA
CAGAGGCCAGCTTTCGACTCCAATGCGATGACGCTGACGCGTTTCGTGCT
GCAGGAGCAGCGAAAGTTCAAGAGCGCCACTGGCGATCTCTCCCAGCTGC
TCAACTCCATCCAGACCGCCATCAAGGCTACATCATCCGCGGTGCGGAAG
GCAGGTATCGCCAAGCTCCATGGATTCGCTGGCGACGTGAATGTCCAAGG
CGAGGAGGTCAAGAAACTGGACGTGCTCTCCAACGAGCTGTTCATCAACA
TGCTGAAGTCATCCTATACCACATGTCTAATGGTTTCCGAGGAGAACGAG
AATGTGATCGAGGTGGAAGTGGAGAAACAGGGCAAATACATCGTGTGCTT
CGATCCCTTGGATGGATCCTCCAACATAGACTGCCTGGTGTCGATCGGTT
CAATCTTCGCCATTTACCGCAAGAAAAGCGATGGTCCGCCCACAGTGGAG
GATGCACTGCAGCCCGGAAATCAGCTGGTGGCCGCCGGCTACGCGCTATA
CGGTTCGGCCACAGCAATTGTCCTGGGTCTGGGTTCGGGAGTGAATGGCT
TCACTTATGACCCGGCCATCGGAGAGTTCGTGCTGACCGATCCCAACATG
CGGGTGCCGGAGAAGGGAAAGATATACTCTATCAACGAGGGATATGCAGC
GGATTGGGAGGATGGTGTCTTCAACTACATTGCGGCCAAGAAGGATCCCG
CCAAGGGAAAGCCCTATGGAGCGCGGTACGTGGGTTCCATGGTCGCGGAT
GTGCATCGCACCATTAAATACGGCGGCATCTTTATCTATCCGGCAACAAA
GTCCGCTCCCAGCGGAAAACTTCGTCTGCTGTACGAGTGCGTGCCCATGG
CCTATCTGATGATCCAGGCTGGAGGTCTGGCCAGCGACGGAAAGATCAGC
ATTTTGGACATTGTGCCCAAGAAGATCCACGAGCGCAGTCCCATATTCCT
AGGATCCAAGTCCGACGTGGAGGAGGCACTTAGCTACTTAAAGTGATTGT
TGTGACTACAGTAACGTATCAATAAAGATCAATTATATTTTTTACTAAGA
AAAAAAAAAAAAAA

RE19105.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:29:08
Subject Length Description Subject Range Query Range Score Percent Strand
fbp-RB 1278 fbp-RB 21..1222 1..1202 5995 99.9 Plus
fbp.c 1198 fbp.c 56..1193 65..1202 5690 100 Plus
fbp-RA 1297 fbp-RA 174..1241 135..1202 5340 100 Plus
fbp-RA 1297 fbp-RA 112..175 1..64 305 98.4 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:57:31
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 19760109..19760830 1199..478 3580 99.7 Minus
chr2L 23010047 chr2L 19761009..19761353 481..137 1710 99.7 Minus
chr2L 23010047 chr2L 19761948..19762019 136..65 360 100 Minus
chr2L 23010047 chr2L 19762591..19762655 65..1 310 98.5 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:39:57 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:57:29
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19761584..19762308 1202..478 3625 100 Minus
2L 23513712 2L 19762487..19762831 481..137 1725 100 Minus
2L 23513712 2L 19763426..19763497 136..65 360 100 Minus
2L 23513712 2L 19764069..19764133 65..1 310 98.5 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:24:46
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19761584..19762308 1202..478 3625 100 Minus
2L 23513712 2L 19762487..19762831 481..137 1725 100 Minus
2L 23513712 2L 19763426..19763497 136..65 360 100 Minus
2L 23513712 2L 19764069..19764133 65..1 310 98.4 Minus
Blast to na_te.dros performed 2019-03-16 02:57:29
Subject Length Description Subject Range Query Range Score Percent Strand
R1A1-element 5356 R1A1-element DMRER1DM 5356bp Derived from X51968 (g8429) (Rel. 23, Last updated, Version 1). 3384..3449 595..659 110 68.7 Plus

RE19105.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:58:11 Download gff for RE19105.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 19760109..19760827 481..1199 99 <- Minus
chr2L 19761010..19761353 137..480 99 <- Minus
chr2L 19761948..19762019 65..136 100 <- Minus
chr2L 19762592..19762655 1..64 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:12:51 Download gff for RE19105.complete
Subject Subject Range Query Range Percent Splice Strand
fbp-RB 1..1032 115..1146 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:56:33 Download gff for RE19105.complete
Subject Subject Range Query Range Percent Splice Strand
fbp-RB 1..1032 115..1146 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:24:56 Download gff for RE19105.complete
Subject Subject Range Query Range Percent Splice Strand
fbp-RA 1..1005 142..1146 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:26:43 Download gff for RE19105.complete
Subject Subject Range Query Range Percent Splice Strand
fbp-RA 1..1005 142..1146 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-08-05 16:37:29 Download gff for RE19105.complete
Subject Subject Range Query Range Percent Splice Strand
fbp-RB 2..1200 1..1199 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:56:33 Download gff for RE19105.complete
Subject Subject Range Query Range Percent Splice Strand
fbp-RB 2..1200 1..1199 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:24:56 Download gff for RE19105.complete
Subject Subject Range Query Range Percent Splice Strand
fbp-RE 4..1202 1..1199 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:26:43 Download gff for RE19105.complete
Subject Subject Range Query Range Percent Splice Strand
fbp-RE 4..1202 1..1199 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:58:11 Download gff for RE19105.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19761587..19762305 481..1199 100 <- Minus
2L 19762488..19762831 137..480 100 <- Minus
2L 19763426..19763497 65..136 100 <- Minus
2L 19764070..19764133 1..64 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:58:11 Download gff for RE19105.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19761587..19762305 481..1199 100 <- Minus
2L 19762488..19762831 137..480 100 <- Minus
2L 19763426..19763497 65..136 100 <- Minus
2L 19764070..19764133 1..64 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:58:11 Download gff for RE19105.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19761587..19762305 481..1199 100 <- Minus
2L 19762488..19762831 137..480 100 <- Minus
2L 19763426..19763497 65..136 100 <- Minus
2L 19764070..19764133 1..64 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:24:56 Download gff for RE19105.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 19762488..19762831 137..480 100 <- Minus
arm_2L 19761587..19762305 481..1199 100 <- Minus
arm_2L 19763426..19763497 65..136 100 <- Minus
arm_2L 19764070..19764133 1..64 98   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:48:05 Download gff for RE19105.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19764070..19764133 1..64 98   Minus
2L 19761587..19762305 481..1199 100 <- Minus
2L 19762488..19762831 137..480 100 <- Minus
2L 19763426..19763497 65..136 100 <- Minus

RE19105.hyp Sequence

Translation from 114 to 1145

> RE19105.hyp
MAASSGDSKMTQQRPAFDSNAMTLTRFVLQEQRKFKSATGDLSQLLNSIQ
TAIKATSSAVRKAGIAKLHGFAGDVNVQGEEVKKLDVLSNELFINMLKSS
YTTCLMVSEENENVIEVEVEKQGKYIVCFDPLDGSSNIDCLVSIGSIFAI
YRKKSDGPPTVEDALQPGNQLVAAGYALYGSATAIVLGLGSGVNGFTYDP
AIGEFVLTDPNMRVPEKGKIYSINEGYAADWEDGVFNYIAAKKDPAKGKP
YGARYVGSMVADVHRTIKYGGIFIYPATKSAPSGKLRLLYECVPMAYLMI
QAGGLASDGKISILDIVPKKIHERSPIFLGSKSDVEEALSYLK*

RE19105.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:37:11
Subject Length Description Subject Range Query Range Score Percent Strand
fbp-PE 334 CG31692-PE 1..334 10..343 1702 100 Plus
fbp-PA 334 CG31692-PA 1..334 10..343 1702 100 Plus
fbp-PD 322 CG31692-PD 1..322 22..343 1640 100 Plus
fbp-PC 322 CG31692-PC 1..322 22..343 1640 100 Plus

RE19105.pep Sequence

Translation from 114 to 1145

> RE19105.pep
MAASSGDSKMTQQRPAFDSNAMTLTRFVLQEQRKFKSATGDLSQLLNSIQ
TAIKATSSAVRKAGIAKLHGFAGDVNVQGEEVKKLDVLSNELFINMLKSS
YTTCLMVSEENENVIEVEVEKQGKYIVCFDPLDGSSNIDCLVSIGSIFAI
YRKKSDGPPTVEDALQPGNQLVAAGYALYGSATAIVLGLGSGVNGFTYDP
AIGEFVLTDPNMRVPEKGKIYSINEGYAADWEDGVFNYIAAKKDPAKGKP
YGARYVGSMVADVHRTIKYGGIFIYPATKSAPSGKLRLLYECVPMAYLMI
QAGGLASDGKISILDIVPKKIHERSPIFLGSKSDVEEALSYLK*

RE19105.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 16:34:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15476-PA 343 GF15476-PA 1..343 1..343 1648 93.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 16:34:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21609-PA 343 GG21609-PA 1..343 1..343 1777 97.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 16:34:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13045-PA 343 GH13045-PA 1..343 1..343 1605 90.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:56:57
Subject Length Description Subject Range Query Range Score Percent Strand
fbp-PF 343 CG31692-PF 1..343 1..343 1744 100 Plus
fbp-PA 334 CG31692-PA 1..334 10..343 1702 100 Plus
fbp-PD 322 CG31692-PD 1..322 22..343 1640 100 Plus
fbp-PC 322 CG31692-PC 1..322 22..343 1640 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 16:34:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18191-PA 343 GI18191-PA 1..343 1..343 1631 92.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 16:34:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25621-PA 344 GL25621-PA 1..344 1..343 1683 92.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 16:34:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16400-PA 344 GA16400-PA 1..344 1..343 1683 92.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 16:34:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16988-PA 343 GM16988-PA 1..343 1..343 1792 98.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 16:34:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21735-PA 342 GD21735-PA 1..337 1..337 1765 99.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 16:34:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14680-PA 343 GJ14680-PA 1..343 1..343 1640 93.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 16:34:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15219-PA 344 GK15219-PA 1..344 1..343 1626 92.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 16:34:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12630-PA 343 GE12630-PA 1..343 1..343 1781 98.3 Plus